Functional characterization of RNA editing and alternative splicing in the carboxyl terminus of cav 1 3 calcium channel
... diversifies the function of calcium channels 1. 4 .1 Mechanism of alternative splicing 1. 4.2 Effects of alternative splicing in L-type calcium channels 1. 4 .3 CaV1 .3 in the brain is alternatively spliced 17 ... Deaminase Acting on RNA (ADAR) 1. 3. 2 Mechanism of RNA editing 1. 3. 3 Substrates of RNA editing 1. 3. 4 Role in neurophysio...
Ngày tải lên: 10/09/2015, 15:48
... CaV1. 3 channels. Figure 3. 6 DHP sensitivity of splice isoforms CaV1. 3LF E31, CaV1. 3LF E31E32, CaV1. 3LF E31aE32, CaV1. 3LF E8 and CaV1. 3LF ΔE 13 as compared to long-form wildtype CaV1. 3LF A2123V. ... properties of splice isoforms CaV1. 3LF E31, CaV1. 3LF E31E32 and CaV1. 3LF E31aE32 compared to CaV1. 3LF A2123V Figure 3. 5 Conservation of molecular determin...
Ngày tải lên: 10/09/2015, 08:26
... cell cycle distribution in nucleus pulposus cells We then used flow cytometry to determine cell cycle progression by quantifying DNA Effects of inhibition of c-Myc transcriptional activity and inhibition ... high and constant level of c-Myc Also, the contribution of Ras/Raf/ERK prevented the rapid degradation of c-Myc by phosphorylation of the serine 62 res...
Ngày tải lên: 09/08/2014, 01:22
OCEANOGRAPHIC PROCESSES OF CORAL REEFS: Physical and Biological Links in the Great Barrier Reef - Chapter 1 docx
... York Washington, D.C © 20 01 by CRC Press LLC Library of Congress Cataloging -in- Publication Data Oceanographic processes of coral reefs : physical and biological links in the Great Barrier Reef / ... on the Great Barrier Reef (GBR), that awe-inspiring structure of biological origin and maintenance which graces and makes distinctive the northeas...
Ngày tải lên: 12/08/2014, 05:21
ADVANCED SERVER VIRTUALIZATION VMware and Microsoft Platforms in the Virtual Data center phần 1 ppt
... 13 9 13 9 14 0 14 2 14 3 14 9 15 1 15 3 15 4 15 6 15 7 15 7 15 8 15 8 16 0 16 1 11 Creating a Microsoft Virtual Server Virtual Machine 16 3 Preparation ... Marshall_AU39 31_ P0 01. indd 3/ 31/ 2006 11 :14 :45 AM Marshall_AU39 31_ P0 01. indd 3/ 31/ 2006 11 :14 :52 AM Chapter Introduction to Server Virtualization This chapter provides a high-level overview an...
Ngày tải lên: 08/08/2014, 21:21
Tài liệu Báo cáo khoa học: Molecular modeling and functional characterization of the monomeric primase–polymerase domain from the Sulfolobus solfataricus plasmid pIT3 doc
... mechanism of both RNA and DNA synthesis [17] In a previous study, we reported the findings of an analysis of the complete sequence of the cryptic plasmid pIT3 isolated from the crenarchaeon S solfataricus ... analyses of the predicted amino acid sequence showed that the C-terminal half of the RepA of the pIT3 plasmid is sequence-similar to the heli...
Ngày tải lên: 18/02/2014, 18:20
Tài liệu Báo cáo khoa học: Molecular and functional characterization of adenylate kinase 2 gene from Leishmania donovani pdf
... stearothermophilus adenylate kinase with bound Ap5A, Mg2+ Ap5A, and Mn2+ Ap5A reveal an intermediate lid position and six coordinate octahedral geometry for bound Mg2+ and Mn2+ Proteins 32, 27 6 28 8 29 Kanaani, ... M (1996) Ancient divergence of long and short isoforms of adenylate kinase: molecular evolution of the nucleoside monophosphate kinase family FEBS Lett...
Ngày tải lên: 21/02/2014, 00:20
Báo cáo khoa học: Molecular and functional characterization of novel CRFR1 isoforms from the skin pptx
... terminus of the CRFR1 isoforms (Fig 1C) The predicted masses of the isoforms without/with V5 tag are as follows: CRFR1a (47.7/52 kDa), CRFR1e1 (10.8/ 15.1 kDa), CRFR1e2 (28.1/32.4 kDa), CRFR1f ... CRFR1 a, b, c and d isoforms differ in their ability to bind ligands and activate G proteins [10,16,25] CRFR1a is the most efficient in the stimulation of cAMP productio...
Ngày tải lên: 07/03/2014, 15:20
Báo cáo khoa học: Molecular and functional characterization of a novel splice variant of ANKHD1 that lacks the KH domain and its role in cell survival and apoptosis docx
... sequence VBARP-L 1.9 VBARP-S 1.3 AACAATGCTGACTGATAGCGGAGGA (Forward) TAAGCTACTACGTAAAGAATATATC (Reverse) GATAAGGTACCTGCACTGACACGGATGAAAGC (Forward) CATATATTCTTTACGTAGTAGCTTA (Reverse) FEBS Journal 272 ... identified and functionally characterized VBARP, a novel splice variant of ANKHD1 Human ANKHD1 gene is a large transcript containing multiple ankyrin repeat motif domains a...
Ngày tải lên: 07/03/2014, 21:20
Báo cáo khoa học: Sulfation of hydroxychlorobiphenyls Molecular cloning, expression, and functional characterization of zebrafish SULT1 sulfotransferases docx
... Detection of zebrafish SULT1 ST1 and ST2 mRNAs and (B) Western blot analysis of zebrafish SULT1 ST1 protein (A) Detection of zebrafish SULT1 ST1 and ST2 mRNAs in cultured zebrafish cells (lanes and 3) and ... sequence of zebrafish SULT1 ST1 displayed, respectively, 50%, 50%, and 49% identity to those of mouse SULT1C1, rat SULT1A1, and human SULT1A1 STs [22...
Ngày tải lên: 08/03/2014, 02:20
Báo cáo khoa học: Identification and functional characterization of a novel barnacle cement protein pptx
... VPPPCDFSIKSKQKQVGVTAGGASVSAKGATSGSGSITCITKTPTSVTKKVAAGNAGVSG Mrcp19k Bacp19k Bicp19k 70 80 90 100 110 120 TSVSAGDGAFGNLAAALTLVEDTEDGLGVKTKNGGKGFSEGTAAISQTAGANGGATVKKA VSASAANGFFKNLGKATTEVKTTKDGTKVKTKTAGKGKTGGTATTIQIADANGGVSEKSL AAAAAGNGVFKNLVTALTNISTTDDITKVQTQTIGSGGTGGAATILQLADANGGAALKEV ... underwater material surfaces was analyzed by: (a) quantitative amino acid analysis; and (b) SPR Pro...
Ngày tải lên: 16/03/2014, 05:20
Báo cáo khoa học: Structural and functional characterization of human Iba proteins ppt
... cross-linking efciency of Iba1 and Iba2 or in the overall morphology of the generated lament bundles Calcium afnity of Iba1 and Iba2 Homodimerization and actin binding of Iba1 and Iba2 were similar ... presented here reveals functional similarities and differences between Iba1 and Iba2 We investigated Ca2+ binding and homodimerization of Iba1 and Iba2 Fur...
Ngày tải lên: 16/03/2014, 06:20
Báo cáo khoa học: Functional characterization of artemin, a ferritin homolog synthesized in Artemia embryos during encystment and diapause doc
... within negatively stained particles of artemin indicated the lack of metal storage capacity Function of an Artemia ferritin homolog A B C Artemin, apoferritin and ferritin inhibit citrate synthase ... denaturation Artemin, apoferritin and ferritin protected citrate synthase against denaturation at 43 °C in a concentrationdependent manner (Fig 3A C) Maximal protec...
Ngày tải lên: 16/03/2014, 11:20