Methods to Analyze Petroleum Pipelines Subjected to a Contingency Level Earthquake pptx
... adequate analytical modeling 12 Restrained vs. Unrestrained • B31.4 covers both buried and aboveground pipelines • Buried pipelines are typically assumed to be restrained against axial elongation ... earthquake negates the need to consider the Level 1 earthquake • Alternate acceptance criteria are justified in cases where typical B31 code criteria can not be met for the Level...
Ngày tải lên: 31/07/2014, 23:21
... 94 V.radiata ARG2 52 KSGEEKVR- GGEKVSWVPDPVTGYYRPEN-TNEIDVADMRATVLG 94 A. thaliana ARG21 53 KGVEES TQKISWVPDPKTGYYRPETGSNEIDAAELRAALLN 203 H.vulgare G3 59 REAEKA AADSSWVPDPVTGHYRPANRSSGADPADLRAAHLG ... of RAMY a nd a- amylase mRNA by GA. Correspondence to Q. Yao, Shanghai Key Laboratory of Agricultural Genetic and Breeding, Agro-Biotechnology Research Center, Shang- hai Academy of Ag...
Ngày tải lên: 16/03/2014, 18:20
... idea to import your footage onto an external hard drive, as video files are large and take up lots of space. If you are using a simple camera like a Flip or a Kodak Zi8, both conveniently create ... ensures that the people in the shot maintain the same left/right relationship. If the camera passes this line, it appears awkward to the viewer and makes your characters appear to...
Ngày tải lên: 29/03/2014, 20:20
báo cáo sinh học:" Conflicting priorities: evaluation of an intervention to improve nurse-parent relationships on a Tanzanian paediatric ward" pptx
... found that a participatory research approach to improve relationships between nursing staff and parents or guardians of patients on the paediatric ward of a busy regional hospital in Tanzania had ... hospital administration and participation of the nurses in the study, and to the data management team at the Joint Malaria Programme, Kilimanjaro Christian Medical Centre, Moshi, Tanza...
Ngày tải lên: 18/06/2014, 17:20
Organization and Development of Russian Business A Firm-Level Analysis_4 pptx
... emerging as a result of the mass-privatization policy; (b) a strong orientation among managers toward closed corporate organization due to the underdeveloped capital and managerial markets; ... strays far from the primary nature of stock companies, that is, an economic mechanism intended to raise capital from a wide range of private investors and increase share- holder wealth a...
Ngày tải lên: 20/06/2014, 23:20
Organization and Development of Russian Business A Firm-Level Analysis_13 pptx
... would like to thank my colleagues Tatiana Dolgopyatova, Larisa Gorbatova, Ichiro Iwasaki and Anna Lukyanova, as well as Lev Freinkman, Daniel Treisman, and other participants in the HSE-NES conference ... and to obtain financial market appraisals of their perform- ance. As a result, two leading Russian state-controlled banks, Sberbank and VTB-Bank, as well as the state-owned Rosneft...
Ngày tải lên: 20/06/2014, 23:20
Organization and Development of Russian Business A Firm Level Analysis_1 pptx
... inclination toward managerial entrenchment is also significant among Russian managers. Furthermore, this result clearly demonstrates that the most attractive reason for Russian managers to operate ... orientation among managers toward closed corporate organization due to the underdeveloped capital and managerial markets; (c) slumping needs for corporate finance; and (d) insuf- ficient...
Ngày tải lên: 21/06/2014, 12:20
Báo cáo hóa học: " A quantitative real time PCR method to analyze T cell receptor Vb subgroup expansion by staphylococcal superantigens" doc
... cgcacatatggatgtcggagttttgaat gcgcggatcctcaactttcgtccttata SElN AF285760 aatgctcatatggacaaaaaagatttaaag gcgcggatccttaatctttatataaaa SElO AF285760 tgcactcgagaatgaagaagatcctaaa cgcgctcgagttatgtaaataaataaac Seo ... (’ 5to3 ’) SEA M18970 cttgtacatatgagcgagaaaagcgaagaa gcgcggatccttaacttgtatataaata SED M28521 cgttctcgagaatgaaaacattgattc cgcgctcgagctacttttcatataaata SEE M21319 ggtagccatatgagcgaagaaat...
Ngày tải lên: 18/06/2014, 16:20
THỰC TRẠNG VÀ GIẢI PHÁP VỀ QUẢN LÝ NHÀ NƯỚC TRONG TỔ CHỨC THỰC HIỆN LUẬT KHIẾU NẠI, TỐ CÁO TẠI ĐỊA BÀN THÀNH PHỐ.DOC
... khoa học và quân sự cu a Việt Nam. Ngày 29/5 vư a qua, Quốc hội a thông qua việc mở rộng đi a giới hành chính. Cùng với đó là hàng loạt những thay đổi lớn về diện tích ... tích tự nhiên, dân số cũng như bộ máy quản lý hành chính. Trước hàng loạt các thay đổi trên, Đảng bộ và người dân Hà Nội đã và đang đoàn kết nhất trí, phát huy tinh thần .....
Ngày tải lên: 06/09/2012, 12:05