... snake. 14. My brother managed to kill the snake just at the time when I were almost exhausted. Supply the correct form of the verbs 1. Cats could fly if they (have) wings. 2. If Peter (study) harder, ... Cats could fly if they (have) had wings. 2. If Peter (study) studied harder, he would get better marks. 3. You will be late for class if you (not, hurry) don't hurry 4. Mary would not have ... better marks. 3. You will be late for class if you (not, hurry). 4. Mary would not have got wet if she (wear) a raincoat. 5. If today (be) a holiday, I would stay in bed for all day long. 6. If...
Ngày tải lên: 23/01/2014, 07:20
Báo cáo khoa học: Crystal structure of the soluble form of the redox-regulated chloride ion channel protein CLIC4 doc
Ngày tải lên: 23/03/2014, 15:21
Báo cáo khoa học: Mapping the binding domains of the aIIb subunit A study performed on the activated form of the platelet integrin aIIbb3 pot
Ngày tải lên: 31/03/2014, 07:20
Báo cáo khoa học: The propeptide in the precursor form of carboxypeptidase Y ensures cooperative unfolding and the carbohydrate moiety exerts a protective effect against heat and pressure pot
... effectively digested by intracellular proteases. Contributions of the carbohydrate moiety The specific activities of glycosylated and unglycosylated CPY are the same as previously reported [13] with the ... higher by 4 °Cthan that of Dgly proCPY, indicating that the carbohydrate moiety exerts a slightly protective effect on the thermal unfolding of proCPY. The P m value for CPY was higher than that of ... its unglycosylated form, though the DV and DG P values were almost the same. The P m value of proCPY was higher than that of its unglycosylated form. This is due to the higher DV value of the unglycosylated...
Ngày tải lên: 07/03/2014, 21:20
Báo cáo y học: "Study of the early steps of the Hepatitis B Virus life cycle"
... confirmed the role of LHBs in the HBV attachment [23]. Recently, the attachment site of LHBs was functionally narrowed down to the amino acids 21 47 of preS1 by employing synthetic peptides. The ... translocation of the internally sequence of PreS1 domain onto the viral surface [62, 63]. This supports the hypothesis that the low pH in the endosome may induce the conformation change of HBV surface ... by the observation of the conformation change of the large surface protein of DHBV at low pH condition [62]. However, the more detail investigation was from the kinetic study of the uptake of...
Ngày tải lên: 03/11/2012, 10:09
Báo cáo y học: Esterified Hyaluronic Acid and Autologous Bone in the Surgical Correction of the Infra-Bone Defects"
... - 2,9 6 ,4 - 6,8 4, 3 - 2,6 2 40 M 50 50 Defect at 3 walls 35 - 36 7,5 - 5,0 4, 3 - 3,8 6 - 6 ,4 3,3 - 1,3 3 40 M 50 50 Defect at 3 walls 44 - 45 7,5 - 5,0 4, 3 - 3,1 4 - 4, 3 3,3 - 1,9 4 28 M 60 ... ophthalmology, dermatology, dentistry and rheumatology [10,11]. Based up on these data the aim of this study was to observe the potential of Esterified Hyaluronic Acid (EHA) as a coadjuvant of grafting ... Department of Dental Sciences and Surgery, University of Bari, Bari, Italy. Correspondence to: Prof. F.R. GRASSI, Professor and Dean, Department of Dental Sciences and Surgery - University of Bari,...
Ngày tải lên: 03/11/2012, 11:35
Tài liệu Báo cáo khoa học: The pro-form of BMP-2 interferes with BMP-2 signalling by competing with BMP-2 for IA receptor binding pptx
... FEBS non-covalent complex of the pro-peptide and BMP-9 can bind to the type I receptor Alk1 [17], the latency- associated polypeptide of TGFb inhibits the interac- tion of TGFb isoforms with type II and III ... phosphorylation. The data presented here suggest that the pro-domain of BMP-2 can alter the signalling properties of the growth factor by modulating the ability of the mature part to interact with the ... transforming growth factor b (TGFb) ⁄ BLP superfamily. The role of the 263 amino acids of the pro-peptide is currently unclear. In order to obtain an insight into the function of the pro-form...
Ngày tải lên: 18/02/2014, 06:20
Tài liệu Báo cáo khoa học: Regulation of dCTP deaminase from Escherichia coli by nonallosteric dTTP binding to an inactive form of the enzyme ppt
... rearranged in the dTTP complex to accommodate the 5-methyl group of the thymine moiety. As a result, the Ala1 24 carbonyl was moved from the 4- oxo ⁄ 4- amino group of the bound nucleotide and the side ... Denmark Synthesis of dTMP by thymidylate synthase proceeds by the reductive methylation of dUMP, which is obtained via one of two parallel pathways. One path- way, considered to be a minor supplier of ... after the transition of the enzyme to a more active form, respectively, t is the time and s is the lag- time. The rate constant, k, for the activation of the enzyme is obtained as 1 ⁄ s. Crystallization Crystals...
Ngày tải lên: 18/02/2014, 16:20
Tài liệu Báo cáo khoa học: Expression and function of Noxo1c, an alternative splicing form of the NADPH oxidase organizer 1 doc
... whether each tran- script possesses the activity to support activation of the Nox enzymes. In this study, we show the expres- sion of alternatively spliced transcripts of the NOXO1 gene, by PCR ... 2C, the mRNA for Noxo1c was expressed substantially in the testis but only slightly in the colon. On the other hand, the Noxo1b mRNA was relatively abundant in the colon and also present in the ... by gp91 phox leads to subsequent formation of microbicidal reactive oxygen species such as hydroxyl radical and hypochlorous acid. Nox1, the second member of the Nox family, is abundant in the...
Ngày tải lên: 19/02/2014, 06:20
Tài liệu Báo cáo Y học: Soluble silk-like organic matrix in the nacreous layer of the bivalve Pinctada maxima A new insight in the biomineralization field pptx
... for the first time the results of a comparative study on the organic matrix extracted from the nacreous layer of the shell from the pearl oyster Pinctada maxima by two very different methods. The ... 7 54. 46 .Marxen,J.C.,Hammer,M.,Gehrke,T.&Becker,W.(1998) Carbohydrates of the organic shell matrix and the shell forming tissue of the snail Biomphalaria glabrata (Say). Biol. Bull. 1 94, 231– 240 . 47 . Miyazawa, T. & Blout, E.R. (1961) The infrared ... a Waters 42 0 fluorimeter. Proline, hydroxyproline and hydroxylysine were examined at 2 54 nm by reverse-phase HPLC of their phenylisothiocarbamate derivatives [26], as reported previously [20]. The...
Ngày tải lên: 21/02/2014, 01:21
Tài liệu Báo cáo Y học: Interallelic complementation provides genetic evidence for the multimeric organization of the Phycomyces blakesleeanus phytoene dehydrogenase doc
... [ 54] . As th e activity of this mutant enzyme could not be restored by the addition of Tween 40 [39], i t can be concluded that the 48 2 Gly residue is important for the activity of the enzyme, ... via three enzymatic steps carried out by the enzymes phytoene synthase, phytoene dehydrogenase and lycopene cyclase. The enzyme phytoene dehydrogenase is able to introduce four dehydrogenations ... while the catalytic activity of the phytoene dehydrogenase in strain S 442 is directly affected by the mutation, strain C5 possesses a f unctional enzyme, likely altered in a region relevant for the...
Ngày tải lên: 22/02/2014, 04:20
Báo cáo khoa học: Crystal structures of the apo form of b-fructofuranosidase from Bifidobacterium longum and its complex with fructose pot
... L 4 –5¢ (Gln4 34- Arg 441 ). These two loops interact with the tips of four other loops: L 1–1¢ (Gly378-Asp375), L 2¢–2 (Ala402-Arg4 04) , L 3¢ 4 (Gly4 24- Gly427) and L 6–6¢ (Glu498-Gly500). The buried surface area of the ... KGKYHMFYQYNPRKPEWG-NICWGHA 1Y4 W FNYDQ-PYRGQYHFSPQKNWMNDPNGLLYH NGTYHLFFQYNPGGIEWG-NISWGHA 3KF5 SIDLSVDTSEYNRPLIHFTPEKGWMNDPNGLFYDKTAKLWHLYFQYNPNATAWGQPLYWGHA 2AC1 NQ-PYRTGFHFQPPKNWMNDPNGPMIY KGIYHLFYQWNPKGAVWG-NIVWAHS 2ADE ... states (Fig. 4) . In the first step of the enzymatic reaction, a nucleophilic attack is performed on the anomeric car- bon of the sugar substrate by the carboxylate of the Asp 54 acting as the primary nucleophile,...
Ngày tải lên: 06/03/2014, 00:21
Báo cáo khoa học: DNA polymerase e associates with the elongating form of RNA polymerase II and nascent transcripts pot
... by carrying out the labelling procedure without primary antibody. The efficiency of blocking was controlled by performing the labelling procedure in the absence of the second primary antibody. ... University of Joensuu, Finland 3 Biocenter Oulu and Department of Pathology, University of Oulu, Finland 4 National University of Ireland, Department of Biochemistry, Cell Cycle Control Laboratory, ... hyperphosphorylated elongating isoform RNA pol IIO RNA pol II exists in a dynamic equilibrium between the hypophosphorylated initiation isoform IIA and the hyperphosphorylated elongating isoform IIO that exhibits...
Ngày tải lên: 07/03/2014, 11:20
Báo cáo khoa học: Purification and structural study of the b form of human cAMP-dependent protein kinase inhibitor pdf
... [15]. Assay of human PKIb activity The activity of purified human PKIb was assayed by the inhibition of the catalytic subunit of cAPK in a 50 lL reaction containing 0.5 units of purified catalytic subunit, 25 ... acetate buffer. The pooled fraction was stored at )20 °C for further study. The concentration of the proteins was determined by the method of Lowry et al. [ 14] and the purity was examined by SDS/PAGE ... showedasinglebandbySDS/PAGE (Fig. 2). The assay of its activity demonstrated that the purified PKIb inhibited the catalytic subunit of cAPK with the specific activity of 6.0 · 10 4 unitÆmg )1 (Fig. 3A) .The K i value...
Ngày tải lên: 07/03/2014, 15:20
Báo cáo khoa học: Isothermal unfolding studies on the apo and holo forms of Plasmodium falciparum acyl carrier protein Role of the 4¢-phosphopantetheine group in the stability of the holo form of Plasmodium falciparum acyl carrier protein docx
... fatty acid elongation, in contrast to the multifunctional enzyme catalyzing all the steps of the type I FAS pathway [4, 5]. ACP is an essential component of both type I and type II fatty acid synthesis ... apparent from the solution denaturation studies that the holo form of the protein has greater stability than the apo form. The differences in the unfolding thermodynamic parameters of the two forms are ... done. The higher stabil- ity of the holo form can be attributed to the number of favorable contacts that the 4 -phosphopantetheine group makes with the surface residues by virtue of a number of hydrogen...
Ngày tải lên: 16/03/2014, 10:20
Báo cáo Y học: S-Decyl-glutathione nonspecifically stimulates the ATPase activity of the nucleotide-binding domains of the human multidrug resistance-associated protein, MRP1 (ABCC1) ppt
... m M of S-decyl-glutathione, the meas- ured ATPase activity represented approximately the basal ATPase activity. This type of behaviour was also observed for the stimulatory effect of S-decyl-glutathione ... concentrations were determined by the Bradford assay using BSA as the standard. The following purified proteins were kindly provided by colleagues: the MBP fusion protein of the NBD of the lactococcal half-transporter ... from the thermoacido- philic Sulfolobus solfataricus, by S. Albers (Groningen University, the Netherlands). ATPase activity The ATPase activity of NBDs was measured by a colori- metric assay [ 34] ....
Ngày tải lên: 17/03/2014, 23:20
Bạn có muốn tìm thêm với từ khóa: