timing requirements for tr so2 group 2 allowance allocations

iec 60269-2 low-voltage fuses - supplementary requirements for fuses for use by authorized person

iec 60269-2 low-voltage fuses - supplementary requirements for fuses for use by authorized person

... Section 10 12 16 20 25 32 40 50 63 80 1O0 125 160 20 0 25 0 31 400 500 630 800 O00 125 0 1.5 1,s 13 2, s 2, s 2. 5 10 16 25 25 35 50 70 95 120 185 24 0 x 150 ou x (30 x 5) x 185 ou x (40 x 5) x 24 0 ou x ... Rated current A 10 12 16 20 25 32 40 50 63 80 1O0 125 160 20 0 25 0 315 400 500 630 800 O00 125 0 Cross-sởctionai area rnmZ 1,5 1,5 23 2. 5 2. 5 10 16 25 25 35 50 70 95 120 185 24 0 x 150 or x (30 x ... Licensee=/5943408001, 03 /29 /20 04 21 :20 :46 MST Questions or comments about this message: please call the Document Policy Group at 303-397 -22 95 6 026 9 -2 Amend .2 O IEC :20 01 -3- FOREWORD This amendment...

Ngày tải lên: 25/12/2013, 10:53

30 315 3
iec 60439-2 low-voltage switchgear and controlgear assemblies - particular requirements for busba

iec 60439-2 low-voltage switchgear and controlgear assemblies - particular requirements for busba

... penetration (see 8 .2. 15) COPYRIGHT International Electrotechnical Commission Licensed by Information Handling Services STD.IEC h0439 -2- ENGL 20 00 m 48g4891 0 727 9 02 IT2 - 28 - 60439 -2 Q CEI :20 00 ... (such as Ll-L2-L3-N to N-L3-L2-L1) COPYRIGHT International Electrotechnical Commission Licensed by Information Handling Services STD-IEC b0437 -2- ENGL 20 00 - 12- 60439 -2 O CEI :20 00 2. 3.1 element ... Electrotechnical Commission Licensed by Information Handling Services S T D - I E C b0439 -2- ENGL 20 00 W 4844891 0 727 887 Obb W - 13- 60439 -2 O IEC :20 00 2. 3.1 flexible busbar trunking unit busbar trunking...

Ngày tải lên: 25/12/2013, 11:05

74 825 14
Báo cáo khoa học: Structural requirements for the apical sorting of human multidrug resistance protein 2 (ABCC2) potx

Báo cáo khoa học: Structural requirements for the apical sorting of human multidrug resistance protein 2 (ABCC2) potx

... (1510–1545) GFP–MRP2 GFP–MRP2D7 GFP–MRP2D11 GFP–MRP2D15 GFP–MRP2D20 GFP–MRP2D25 GFP–MRP2D25 MAKE GFP–MRP2D50 GFP–MRP2D100 73 69 65 16 15 1 18 18 20 17 64 59 59 64 35 13 15 67 20 33 32 35 65 GKIIECGSPEELLQIPGPFYFMAKEAGIENVNSTKF ... jaundice in rats with a mutation in a Ó FEBS 20 02 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 multidrug resistance associated-protein gene Science 27 1, 1 126 – 1 127 Ito, K., Suzuki, H., Hirohashi, T., ... four transient transfections Experiments were performed without butyrate induction Construct Time (days) % Apical % Vesicles % ER GFP–MRP2 4 70 81 77 71 2 21 11 55 47 54 47 78 69 69 63 11 12 22...

Ngày tải lên: 31/03/2014, 09:20

11 523 0
Softswitch for the next generation network   group 2

Softswitch for the next generation network group 2

... and core transmit network  among the heterogeneous network  The transport layer accomplishes the centralization of transmission the control information between the service date & control layer ... Connect The softswitch will play a strategic role in the nextgeneration public network infrastructure for voice, video and data communications H. 323 Q.931/Q .29 31 Softswitch SIP-T Softswitch Cellular ... solution like centralized switchboard  It is a solution combining the distribution and centralization  It is a soft solution and the important method is the interface protocols between control logic...

Ngày tải lên: 01/06/2014, 12:25

28 455 1
CiGi Technology Limited Consultants for Requirements and Systems Engineering phần 2 potx

CiGi Technology Limited Consultants for Requirements and Systems Engineering phần 2 potx

... Limited Consultants for Requirements and Systems Engineering Data Model in Action Requirement Attributes Telelogic User Group Conference - 20 th November 20 07 19 Consultants for Requirements and ... User Group Conference - 20 th November 20 07 17 Consultants for Requirements and Systems Engineering Data Model Integration Services Support Environment (ISSE) Telelogic User Group Conference - 20 th ... and easily picked up on the job …” Email from a DOORS user: 25 October 20 07 Telelogic User Group Conference - 20 th November 20 07 12 Simpo PDF Merge and Split Unregistered Version - http://www.simpopdf.com...

Ngày tải lên: 13/08/2014, 22:20

10 253 0
Synthesis and characterization of group 11, 12 and 13 metal selenocarboxylates potential single molecular precursors for metal selenide nanocrystals 2

Synthesis and characterization of group 11, 12 and 13 metal selenocarboxylates potential single molecular precursors for metal selenide nanocrystals 2

... critical to the formation of Ag2Se NCs 6 .2 Results and Discussion 6 .2. 1 Formation of Ag2Se NCs from [(Ph3P)3Ag2(SeC{O}Ph )2] Previously, our laboratory have demostrated that Cu2-xSe NPs can be synthesized ... Selenide NPs Synthesis of Cu2-xSe NPs and Microflakes from [(Ph3P)3Cu2(SeC{O}Ph )2] 7.1 Introduction Cu2-xSe is an extrinsic p-type semiconductor with a direct band gap of 2. 2 eV and an indirect energy ... obtained at low temperature (40.3 ± 9.5 nm for 22 0 ˚C; 28 .3 ± 10.1 nm for 25 0 ˚C and 30.5 ± 6.3 nm for 28 0 ˚C) This suggested that more nucleic are being formed at high temperatures because in the...

Ngày tải lên: 14/09/2015, 10:19

45 393 0
AN0877   devicenet™ group 2 slave firmware for PIC18 with CAN

AN0877 devicenet™ group 2 slave firmware for PIC18 with CAN

... sheet (DS41159) for information on the CAN module B 125 k_BRG3_SEG2PH B 125 k_BRG2_PRSEG B 125 k_BRG2_SAM B250k_BRG1_SJW B250k_BRG1_PRESCALE B250k_BRG2_SEG2PHTS B250k_BRG3_WAKFIL B250k_BRG2_SEG1PH Set ... 11F-3, No 20 7 Tung Hua North Road Taipei, 105, Taiwan Tel: 886 -2- 2717-7175 Fax: 886 -2- 2545-0139 EUROPE Austria Durisolstrasse A-4600 Wels Austria Tel: 43- 724 2 -22 44-399 Fax: 43- 724 2 -22 44-393 Denmark ... 135-8 82 Tel: 82- 2-554- 720 0 Fax: 82- 2-558-59 32 or 82- 2-558-5934 Atlanta Unit 915 Bei Hai Wan Tai Bldg No Chaoyangmen Beidajie Beijing, 100 027 , No China Tel: 86-10-8 528 2100 Fax: 86-10-8 528 2104 3780...

Ngày tải lên: 11/01/2016, 14:34

34 808 0
Test paper for Project Leader No 2

Test paper for Project Leader No 2

... a management structure, use the rule of thumb from the answer to question to calculate how much effort is needed where, write profiles for the various positions, and fill them form new or existing ... going to be a key part of your company’s strategy going forward What’s your next move? (a) (b) (c) (d) Identify your requirements – what you would be trying to achieve by using this technology ... speech to troops to try to lift morale Then consider your next move (e) Go out immediately and give a “don’t work harder – work smarter” speech to troops and then consider your text move Q .2 Same...

Ngày tải lên: 01/11/2012, 10:09

7 632 2
Test for general it knowledge 2

Test for general it knowledge 2

... a Kiến tr c mạng Star đắt tiền kiến tr c mạng Bus tin cậy dễ bảo tr b Kiến tr c mạng Star rẻ tiền kiến tr c mạng Bus tin cậy kiến tr c mạng Bus c Kiến tr c mạng Bus rẻ tiền kiến tr c mạng ... Server 20 Hệ quản tr sở liệu chiếm thị phần lớn thể giới a Access b FoxPro c Oracle d Paradox 21 Hệ sở liệu yếu chức bảo mật: a Access b FoxPro c Oracle d DB2 22 Bộ nhớ tối thiểu máy tính PC a 120 ... gồm 25 6 ký tự có 128 ký tự mở rộng Câu sau đúng: a Chương tr nh dịch chương tr nh nguồn hãng làm sản phẩm phần mềm cao cấp viết nên, ví dụ Microsoft, Borland b Chương tr nh dịch chương tr nh...

Ngày tải lên: 02/11/2012, 13:20

5 541 0
English for Tourism and Hospitality 2

English for Tourism and Hospitality 2

... mind saying that again please? C: 0003 0078 22 78 3308 A: 5 526 4671 98 02 88 92 B: I’m sorry, I didn’t hear you Was that double eight five two? A: No, 88 92 The Chant Practise saying this chant out ... practice - Asking for Clarification Read the following short dialogues out loud A: 8869 6719 9908 6683 B: Could you repeat that please? A: 8869 6719 9908 6683 A: 0003 0078 22 78 3308 B: Would ... loud Could you repeat, Could you repeat, Could you repeat that please? Oh -2 double 6? Or Oh -2 double 3? Answers: 1) welcome 2) expiry 3) both 4) repeat 5) double 6) credit card ...

Ngày tải lên: 05/11/2012, 09:52

2 1,4K 41
English for Tourism and Hospitality 2

English for Tourism and Hospitality 2

... two Leo: 4434 123 4 5678 99 02 Mona: That's right 123 4 5678 99 02 Quí bạn theo dõi Học Tiếng Anh Cho Ngành Du Lịch Đài Úc Châu thực Bài Học 2: Nhận Giữ Phòng Qua Điện Thoại Lesson 2: Taking a Reservation ... two rooms for Ms White and Mr Webber (Tôi giữ hai phòng cho cô White ông Webber.) Leo: from Wednesday the 25 th to Saturday the 28 th of September (Từ thứ Tư ngày 25 đến thứ Bảy ngày 28 tháng Chín.) ... you I've booked two rooms for Ms White and Mr Webber from Wednesday the 25 th to Saturday the 28 th of September Mona: Thank you Leo: You're welcome We'll see you on the 25 th, Ms White Mona: Thanks...

Ngày tải lên: 05/11/2012, 16:27

8 759 8
A research proposal submitted  in partial fulfillment of the requirements for the degree of Master of Business Administration

A research proposal submitted in partial fulfillment of the requirements for the degree of Master of Business Administration

... 43 .2 3.18 30.0 product display 3. 32 20.5 3.84 26 .0 cold storage 3 .20 13.6 3. 62 22. 0 10 distance 3.00 13.6 2. 94 6.0 11 location 2. 82 13.6 2. 86 4.0 12 store size 2. 82 11.4 3 .26 14.0 13 check out 2. 50 ... storage T-tests 35 .2 27.3 22 .7 35.8 19.9 D D 10 store size 3.05 1.14 13.6 11 location 2. 96 1.14 10 .2 12 distance 2. 92 1 .23 10 .2 13 check out 2. 73 1 .29 13.1 14 air conditioning 2. 50 1 .21 9.1 Note: 1= ... profile vi 10 20 20 21 23 24 25 27 28 29 30 31 31 32 33 33 34 35 36 37 List of figures Figure 1.1 2. 1 2. 1 3.1 3 .2 3.3 4.1 4 .2 4.3 4.4 4.5 4.6 Title Page Analytical frame work Store choice Patronage...

Ngày tải lên: 13/04/2013, 10:30

51 1K 3
English test for 10th form(No 2- 2nd term)

English test for 10th form(No 2- 2nd term)

... ( §Ò 23 4) D.football match D five D Wednesday D see C©u I: 4ý x 0 ,25 = ®iÓm 1C D A D C©u II: 15ý x 0 ,2= ®iÓm A D C B A 10 C 11 A 12 B 13 D 14 B 15 C 16 A 17 C 18 C 19 B C©u III: 5ý x 0,5 = 2, 5 ... evey………….years A two B three C four 15 Don’t forget……… him for coffee when you see him A to invite B invite C inviting D in week D What time D to D 21 th D going D.basketball D was/then D the D ... 19th C 20 th 10 They are …………….go on holiday tomorrow morning A wll B going to C will be 11 Pele was a famous………….player un the world A tennis B volleyball C football 12 It………not until 20 08 ………she...

Ngày tải lên: 24/06/2013, 01:28

4 1,6K 4
hoa 8 tr bo ky 2

hoa 8 tr bo ky 2

... 4P + 5O2 -> 2P2O5 2Fe + O2 -> 2FeO CaO + H2O -> Ca(OH )2 Fe(OH )2 + O2 + 2H2O-> Fe(OH)3 Nội dung ghi bảng I Sự oxi hoá Ví dụ : t0 4P + 5O2 -> 2P2O5 2Fe + O2 -> 2FeO CH4 + 2O2 -> CO2+ 2H2O ĐN (SGK) ... 100 : 90 = 2, 222 lit => nO2 = 2, 222 : 22 ,4 = 0,01 mol PTHH : to 2KMnO4 -> K2MnO4 + MnO2 + O2 x 0,099 => x = 0,198 => m KMnO4 = 0,198 x 158 = 31 ,28 4 g b PT: to 2KClO3 -> 2KCl + 3O2 x 0,099 mol ... d tr c - Sau tính chất lại theo chất phản ứng hết Ta có : nH2= 8,4 : 22 ,4 = 0,375 mol nO2 = 2, 8 : 22 ,4 = 0, 125 mol TPHH : 2H2 + O2 -> 2H2O Lập tỉ lệ : nH2 theo đề / nH2 theo pt so với nO2 theo...

Ngày tải lên: 03/08/2013, 01:28

58 219 0
BUILDING CODE REQUIREMENTS FOR STRUCTURAL CONCRETE (ACI 318-99) AND COMMENTARY

BUILDING CODE REQUIREMENTS FOR STRUCTURAL CONCRETE (ACI 318-99) AND COMMENTARY

... CHAPTER 22 —STRUCTURAL PLAIN CONCRETE 318-335 22 .5—Strength design 22 .6—Walls 22 .7—Footings 22 .8—Pedestals 22 .9—Precast members 22 .10—Plain concrete in earthquake-resisting structures 22 .0—Notation ... 20 .5—Acceptance criteria 20 .6—Provision for lower load rating 20 .7—Safety CHAPTER 21 —SPECIAL PROVISIONS FOR SEISMIC DESIGN 318 -29 9 21 .0—Notation 21 .1—Definitions 21 .2 General requirements 21 .3—Flexural ... 12. 12 Development of negative moment reinforcement 12. 13—Development of web reinforcement 12. 14—Splices of reinforcement—General 12. 15—Splices of deformed bars and deformed wire in tension 12. 16—Splices...

Ngày tải lên: 03/08/2013, 11:24

1,3K 1,8K 16
Requirements for the Generic Bus Driver Model

Requirements for the Generic Bus Driver Model

... driver creates an abstraction (in the form of a data structure) for each function it discovers The driver that the bus driver loads to control the discovered function uses this abstraction to access ... installed on the platform Problems with this method are: • Detection methods used by drivers might conflict with hardware already installed on the platform For example, if a platform has a drill ... meet the requirements of discoverability and multiplexability • Discoverable - If special information is required in descriptors to group interfaces into functions, this is a problem for a generic...

Ngày tải lên: 07/10/2013, 00:20

6 326 0
Requirements for entry

Requirements for entry

... qualifications Chemistry with either Mathematics or Biology or Physics Graduate entry available UKCAT compulsory for graduate entry BMAT compulsory for undergraduate entry Graduate entry available UKCAT ... perseverance are part of the same package They feed on dual enthusiasm for science and for the healing art of medicine 29 Requirements for entry They are inspired by curiosity and enriched by sparks of ... Chemistry required Graduate Partnership arrangement with entry course Cardiff for five-year medical degree Contact medical school for further details 370 tariff points Peninsula Table 3 .2 For applicants...

Ngày tải lên: 01/11/2013, 09:20

22 270 0
w