regulation of extracellular k concentration

... Takaya K, Tagami T, Ogawa Y, Hosoda K, Akamizu T, Suda M, Koh T, Natsui K, Toyooka S, Shirakami G, Usui T, Shimatsu A, Doi K, Hosoda H, Kojima M, Kangawa K, Nakao K: Stomach is a major source of ... plasma ghrelin-like immunoreactivity levels in humans J Clin Endocrinol Metab 2001, 86:4753-4758 Krsek M, Rosicka M, Haluzik M, Svobodova J, Kotrlikova E, Justova V, Lacinova Z, Jarkovska Z: Plasma ... and pharmacological aspects of ghrelin Endocr Rev 2004, 25:426-457 10 Klok MD, Jakobsdottir S, Drent ML: The role of leptin and ghrelin in the regulation of food intake and body weight in humans:...

Ngày tải lên: 13/08/2014, 20:22

... 96:14783–14788 Kihara M, Nakai W, Asano S, Suzuki A, Kitada K, Kawasaki Y, Johnston LH, Sugino A (2000) Characterization of the yeast Cdc7p/Dbf4p complex purified from insect cells Its protein kinase ... of Xlinked mutants of Drosophila melanogaster which are sensitive to mutagens Genetics 84:485–506 Brown GW, Kelly TJ (1999) Cell cycle regulation of Dfp1, an activator of the Hsk1 protein kinase ... replication in the hamster dihydrofolate reductase gene initiation zone Mol Cell Biol 18:3266–3277 Kondo T, Kobayashi M, Tanaka J, Yokoyama A, Suzuki S, Kato N, Onozawa M, Chiba K, Hashino S, Imamura M...

Ngày tải lên: 25/10/2013, 21:20

... Fridtjof Nansen Institute, 1994), pp 32–3 A Kolodkin, O Kulistikova and E Mokhova, ‘Matters of Responsibility for Mariner Pollution under the Legislation of the Russian Federation’, INSROP Working ... 11 of the NSR Regulations N Koroleva, V Markov and A Ushakov, Legal Regime of Navigation in the Russian Arctic (Moscow: Russian Association of International Maritime Law, 1995), p 75 Franckx, ... 15 of the Economic Zone Edict; Arts and 15 of the Environmental Edict; and Art 11 of the Decree of the Council of Ministers of the USSR, June 1990, ‘On Measures of Securing the Implementation of...

Ngày tải lên: 01/11/2013, 09:20

... activation of the ERK signal cascade and that miR-34a downregulates MEK1, which is one of the main regulators of ERK signaling, indicates that miR-34a is involved in negative-feedback regulation of the ... MEK1, CDK4, CDK6 Oct4, SOX2, KLF4 ERa TLX, NFKB1 E2F, Myc ZEB1 ⁄ deltaEF1, SIP1 ⁄ ZEB2 Cyclin D1 ERa c-Myb Dicer Spry1, Spry2, PDCD4, NFIB MeCP2 VAV1 p53, ELK1, ERK-MAPK Oct4 ERa TLX, TLR4-NF-kappaB ... MicroRNA regulation of a cancer network: consequences of the feedback loops involving miR-17-92, E2F, and Myc Proc Natl Acad Sci USA 105, 19678–19683 53 Bracken CP, Gregory PA, Kolesnikoff N, Bert...

Ngày tải lên: 14/02/2014, 19:20

... [65] MAPK pathways consist of three major kinases: the activation of p38 MAPK, the extracellular signalregulated kinases (ERK) and Jun NH2 terminal kinases (JNK) [66] JNK and p38 MAPK activation ... direct dephosphorylation of Ser112 and negative regulation of the ERK pathway via p38 MAPK, both of which lead to impaired phosphorylation of Ser112 [70] After dephosphorylation of Ser112, Ser136 becomes ... multiple protein kinases [88], including the major phosphorylation site Thr125 The direct phosphorylation of this site by ERK, but not JNK or p38 MAPK/MAKP, suppresses the processing of caspase-9...

Ngày tải lên: 14/02/2014, 22:20

... study of the prevalence of PKM2 in cancers and the effect of PKM2 on tumorigenesis is still required NADPH A key molecule produced as a result of the promotion of the oxidative PPP by PKM2 is ... p53 PI 3K PTEN Glycolysis AMPK AKT Lactate Pyruvate TIGAR p53 SCO2 LKB1 mTOR PDH PDK Acetyl-CoA TCA OCT1 MYC HIF b Proliferating tumour cell Lactate Glucose MCT GLUT Glucose PI 3K AKT PKM2 TIGAR ... splicing The inclusion of exon in the PK mrnA leads to translation of the PKM1 isoform, whereas inclusion of exon 10 produces PKM2 (ReF 71) MyC upregulates the expression of heterogeneous nuclear...

Ngày tải lên: 15/02/2014, 04:20

... Ferris DK (1997) Cell cycle regulation of the human polo-like kinase (PLK) promoter J Biol Chem 272, 9166–9174 Rother K, Li YY, Tschop K, Kirschner R, Muller GA, ¨ ¨ Mossner J & Engeland K (2007) ... NJ & Hickson ID (1998) Physiological regulation of eukaryotic topoisomerase II Biochim Biophys Acta 1400, 121–137 73 Adachi N, Nomoto M, Kohno K & Koyama H (2000) Cell-cycle regulation of the ... CDK1 cell division cycle ⁄ cyclin-dependent kinase cell division cycle 25 homolog C CDC28 protein kinase regulatory subunit mitotic kinesin-like protein ⁄ kinesin family member 23 polo-like kinase...

Ngày tải lên: 16/02/2014, 09:20

... Alpha Beta Gamma Epsilon Delta N AKSSDKEEKHRK EGP-GSKTGDKEEKHRK N -KTLEKMEKHRK K ASEKDAKHRK EKAPLRKTSEAAVKEGKTEKTD : : : * * Fig Multiple alignment of AP-2a, AP-2b, AP-2c, AP-2d, and ... VLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETE VLRRAKSKNGGRSLRERLEKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYICETE VLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAAHVTLLTSLVEGEAVHLARDFAYVCEAE VLRRAKSKNGGRCLRERLEKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETE ... FPAKAVAEFLNRQHSD-PNEQVTRKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEP FPAKAVSEYLNRQHTD-PSDLHSRKNMLLATKQLCKEFTDLLAQDRTPIGNSRPSPILEP FPSKPVAEYLTRPHLGGRNEMAARKNMLLAAQQLCKEFTELLSQDRTPHGTSRLAPVLET FPAKAAAEYLCRQHAD-PGELHSRKSMLLAAKQICKEFADLMAQDRSPLGNSRPALILEP FPAKAVGEHLARQHME-QKEQTARKKMILATKQICKEFQDLLSQDRSPLGSSRPTPILDL...

Ngày tải lên: 16/02/2014, 09:20

... K Bjork and L Sistonen ¨ Regulation of HSFs the results imply that, in particular, the promoterbound pool of HSF2 proteins is subjected to degradation (J .K Ahlskog, J .K Bjork, A.N Elsing, M Kallio, ... compilation ª 2010 FEBS J K Bjork and L Sistonen ¨ Pirkkala L, Nykanen P & Sistonen L (2001) Roles of ¨ the heat shock transcription factors in regulation of the heat shock response and beyond FASEB ... Goodson ML, Park-Sarge OK & Sarge KD (2001) Regulation of heat shock transcription factor by stress-induced SUMO-1 modification J Biol Chem 276, 40263–40267 59 Hietakangas V, Ahlskog JK, Jakobsson AM,...

Ngày tải lên: 18/02/2014, 04:20

... 2009 FEBS H M Hardin et al ă Enzyme kinetics for low substrate concentrations k2 e s R1 sị ẳ tot ỵ k1 s k2 p k1 1s k1 k2 k2 pị 70 etot ỵ k ks k 2k1 s k1 ịpị2 k k 1 2 50 q! ỵ 4asịcsị=ẵbsị2 30 ... with the denitions: Vs ẳ k2 etot ; Vp ẳ k1 etot ; Ks ẳ k1 ỵ k2 ị =k1 Kp ẳ k1 ỵ k2 ị =k2 and 13ị yields the reversible MichaelisMenten form: _ sẳ Vs Ks V s Kp p p p s ỵ Ks ỵ Kp 14ị This is the QSSA-reduced ... (11) and obtain: _ sẳ Vp Vs Ks s Kp pỵR1 sị1ị h Vp p s K s ỵ K p ỵ Vs p s 1ỵ Ks ỵ Kp  p s 1ỵ Ks ỵ Kp  Vp Vs Ks s Kp p i 21ị with Vs, ,Kp expressed in terms of k1 , ,k) 2 via the parameter change...

Ngày tải lên: 18/02/2014, 06:20

... K, Miyata Y, Tanaka S, Segawa K, Furukawa S, Tochino Y, Komuro R, Matsuda M et al (2007) Adipose tissue hypoxia in obesity and its impact on adipocytokine dysregulation Diabetes 56, 901–911 Kulshreshtha ... Park C, Choi K & Bickel PE (2006) OP9 mouse stromal cells rapidly differentiate into adipocytes: characterization of a useful new model of adipogenesis J Lipid Res 47, 450–460 Hosogai N, Fukuhara ... the regulation of miR-27 expression Our data suggest that the miR-27 gene family is potentially an important class of negative regulators of adipogenesis and may play a role in the regulation of...

Ngày tải lên: 18/02/2014, 08:20

... Biochem Cell Biol 29, 715–720 22 Turk B, Bieth JG, Bjork I, Dolenc I, Turk D, Cimerman N, Kos J, Colic A, Stoka V & Turk V (1995) Regulation of the activity of lysosomal cysteine proteinases by ... peaks corresponding to molecular weights of 161.8, 28.2 and 13.2 kDa, respectively Regulation of cathepsin B activity The formation of the cathepsin B ⁄ cystatin C complex was seen as a shift of ... microliters of Abz-GIVRAK(Dnp)-OH (final concentration lm) and 10 lL of 2A2 mAb or NaCl ⁄ Pi were added to a well of a black microtiter plate and the reaction was initiated by adding 85 lL of activated...

Ngày tải lên: 18/02/2014, 11:20

... Dreijerink KM, Mulder KW, Winkler GS, Hoppener JW, Lips CJ & Timmers HT (2006) Menin links estrogen receptor activation to histone H 3K4 trimethylation Cancer Res 66, 4929–4935 36 Lee J, Saha PK, Yang ... level of MLL1 mRNA Interestingly, upon downregulation of MLL1, E2-mediated upregulation of HOXC13 was slightly decreased (Fig 4A, lane 3) Similar results were observed for MLL2 and MLL4 downregulation ... ERE2, ERE3 and ERE4 of the HOXC13 promoter As seen in Fig 5A, no significant binding of actin was observed in any of the EREs, irrespective of the absence and presence of E2 Binding of ERa and ERb...

Ngày tải lên: 18/02/2014, 14:20

... 472, 312–316 25 Kurganov BI, Dorozhko AK, Kagan ZS & Yakovlev VA (1976) The theoretical analysis of kinetic behaviour of ‘hysteretic’ allosteric enzymes I The kinetic manifestations of slow conformational ... Wilson KS (1992) Crystal structure of a dUTPase Nature 355, 740–743 Chan S, Segelke B, Lekin T, Krupka H, Cho US, Kim MY, So M, Kim CY, Naranjo CM, Rogers YC et al (2004) Crystal structure of the ... with a stochiometry of : of dTTP bound per subunit of dCTP deaminase 4192 Mutational analysis of amino acid residues involved in dTTP regulation of dCTP deaminase The design of the mutant enzymes...

Ngày tải lên: 18/02/2014, 16:20

... of regulatory volume increase is a key component of apoptosis FEBS Lett 580, 6513–6517 30 Wu KL, Khan S, Lakhe-Reddy S, Wang L, Jarad G, Miller RT, Konieczkowski M, Brown AM, Sedor JR & Schelling ... associated with caspase cleavage of the NHE1 Na+ ⁄ H+ exchanger Am J Physiol 284, F829–F839 31 Wu KL, Khan S, Lakhe-Reddy S, Jarad G, Mukherjee A, Obejero-Paz CA, Konieczkowski M, Sedor JR & Osmosensing ... EH, Kim JI, Bang ES, Heo JS, Lee JS, Kim EY, Lee JE, Park WY, Kim SH, Kim HS et al (2002) Targeted disruption of hsp70.1 sensitizes to osmotic stress EMBO Rep 3, 857–861 Neuhofer W, Holzapfel K, ...

Ngày tải lên: 18/02/2014, 16:20

... malabsorption of folate was observed over the entire course of ethanol treatment of months Determination of the kinetic constants of [3H]folic acid uptake in BBMVs V(pmol/30 sec/mg protein) The effect of ... sustain key biosynthetic reactions [1] In addition, the cellular concentration of folate cofactors, in different oxidative states, governs the intricate network of methylation reactions of DNA, ... Coulter LS 6500, Beckman Coulter, Fullerton, CA, USA) For the determination of the kinetic constants Km and Vmax, transport of [3H]folic acid was measured by varying the concentration of [3H]folic acid...

Ngày tải lên: 18/02/2014, 16:20

... determination of the pKa of the active site cysteine and the function of the conserved histidine 402 Biochemistry 32, 9340–9345 28 Salmeen A, Andersen JN, Myers MP, Meng TC, Hinks JA, Tonks NK & Barford ... ZX, Ferrans VJ, Irani K & Finkel T (1995) Requirement for generation of H2O2 for plateletderived growth factor signal transduction Science 270, 296–299 25 Lee SR, Kwon KS, Kim SR & Rhee SG (1998) ... bands of interest were cut out and sequenced by Edman degradation at Department of Lipid Chemistry, Utrecht University Acknowledgements The authors would like to thank A Weiss (University of California,...

Ngày tải lên: 18/02/2014, 17:20

... apprentice at the time the work order is taken shall offer to show, and upon acceptance of the offer, shall show the parts to the customer upon completion of the work, except that the dealer shall ... customer at the time of the completion of the work excepting such parts as may be exempt because of size, weight, or other similar factors from this requirement by rule of the board and excepting ... to it; (7) Any wilful departure from or disregard of accepted practices or professional standards; (8) Making false promises of a character likely to influence, persuade, or induce a customer...

Ngày tải lên: 19/02/2014, 04:20

... proteins Hepatology 29, 839–848 Jaworski J, Biedermann IW, Lapinska J, Szklarczyk A, Figiel I, Konopka D, Nowicka D, Filipkowski RK, Hetman M, Kowalczyk A & Kaczmarek L (1999) Neuronal excitation-driven ... 25731–25734 26 Schuringa JJ, Dekker LV, Vellenga E & Kruijer W (2001) Sequential activation of Rac-1, SEK-1 ⁄ MKK-4, and protein kinase Cdelta is required for interleukin-6induced STAT3 Ser-727 phosphorylation ... 37, 208–215 Kim YK, Bae GU, Kang JK, Park JW, Lee EK, Lee HY, Choi WS, Lee HW & Han JW (2005) Cooperation of H2O2-mediated ERK activation with Smad pathway in TGF-beta1 induction of p21 (WAF1...

Ngày tải lên: 19/02/2014, 05:20

... insights for the feedback regulation of heme catabolism Tohoku J Exp Med 200, 167–186 5344 12 Nakayama M, Takahashi K, Kitamuro T, Yasumoto K, Katayose D, Shirato K, Fujii-Kuriyama Y & Shibahara ... Biol Chem 278, 9125–9133 14 Udono-Fujimori R, Takahashi K, Takeda K, Furuyama K, Kaneko K, Takahashi S, Tamai M & Shibahara S (2004) Expression of heme oxygenase-1 is repressed by interferon-gamma ... Zhang Y, Furuyama K, Kaneko K, Ding Y, Ogawa K, Yoshizawa M, Kawamura M, Takeda K, Yoshida T & Shibahara S (2006) Hypoxia reduces the expression of heme oxygenase-2 in various types of human cell...

Ngày tải lên: 19/02/2014, 05:20