notch signaling in vascular development

... Hong et al., 2006) 1.4 Notch Signaling: Regulation of Notch Signaling and Function in Kidney 1.4.1 Notch Signaling: Lateral Inhibition and Lateral Induction Notch signaling is an evolutionarily ... and the inner ear, and that of Delta -Notch signaling in neural tissue, the inner ear and the intestine In all these cases, the blockage of Notch signaling leads to a failure in lateral inhibition ... pax2a in the duct (Zecchin et al., 2005) There are four Notch receptors in zebrafish: notch1 a, notch1 b, notch3 (notch5 ) and notch2 (notch6 ) (Kortschak et al., 2001), with the exception of notch3 ,...

Ngày tải lên: 14/09/2015, 10:29

... lines indicate protein-protein binding interactions, and arrows refer to “acts on” interactions such as proteolysis, expression, and protein-protein interactions Genes up regulated are shown in ... from in situ to invasive carcinoma and in a minor percentage brain, liver and pancreas metastases were observed Inactivation of p53 and pRB occurs in the majority of neuroendocrine lung carcinomas ... subsequently leading to progression of the cell into the S-phase [14] Furthermore, E7 binds to inhibitors of cyclin-dependent kinases (p16, p21), increasing the level of phosphorylated pRb In this way,...

Ngày tải lên: 18/06/2014, 16:20

... mapping to define in detail the contribution of the NC to the forming eye in mice In addition, we used conditional gene targeting to inactivate TGF␤ signaling in NC stem cells and, as a result, in ... cultured in DMEM:F12 medium (Gibco/Invitrogen, Carlsbad, USA) containing 10% fetal bovine serum (Sigma) Following a 60 incubation in DMEM:F12 medium containing 0.1% bovine serum albumin at 37°C, ... suggesting that both transcription factors are involved in mediating TGF␤ signaling in ocular cells during development Interestingly, a report of a family suffering from both Axenfeld-Rieger’s anomaly...

Ngày tải lên: 06/08/2014, 18:21

... demonstrate vascular alterations in TβRIIΔk-fib mice, additional studies are needed to establish increased TGFβ signaling in fibroblasts as a molecular mediator of the vascular disease in SSc The ... resulted in increased vascular stiffness The contractility of isolated aortic rings upon incubation with KCl, α-adrenoreceptor agonists or thromboxane analogues was reduced in TβRIIΔk-fib mice Surprisingly, ... TβRIIΔk = kinasedeficient TGFβ receptor type II; TGF = transforming growth factor; vSMC = vascular smooth-muscle cell Competing interests The authors declare that they have no competing interests...

Ngày tải lên: 12/08/2014, 14:21

... Wnt and Hh signaling in the swimbladder development 4.7.1 Wnt signaling maintained Hh signaling and is negatively regulated by Hh signaling 4.7.2 Hh signaling might be required to maintain wif1 ... fibroblast growth factor (FGF) signaling by trapping FGF receptors in the ER Finally, insulin-like growthfactor (IGF) binding protein-4 (IGFBP-4) antagonizes Wnt signaling by binding to both LRP6 and Fz ... Wnt antagonists and inhibitors 1.7.9 Wnt target genes 1.7.10 Wnt signaling in lung and lung development 1.7.11 Wnt signaling in Xenopus lung development 1.7.12 Wnt signaling in Zebrafish 1.8 Objectives...

Ngày tải lên: 11/09/2015, 09:07

... an extraordinary combinatorial potential for signaling (Malbon 2005) Since the initial identification of the role of G proteins in development in 1988, these signaling cascades have since been ... composed of MAP kinase, MAP kinase kinase (MAPKK) and MAP kinase kinase kinase (MAPKKK) G-protein mediated mating signaling activates Ste11, a MAPKKK in S cerevisiae Ste11, in turn, phosphorylates ... effectors Regulator of G-protein signaling (RGS) proteins stimulate signal termination by acting as GTPase-accelerating proteins (GAPs) for Gα, dramatically enhancing their intrinsic rate of GTP hydrolysis...

Ngày tải lên: 14/09/2015, 09:13

... PLTPHRVRLTKIDHTFLSEDAINNLGSLKFSQSNRMPDPKDVARIVTTTTTTTFSMAKEM PLSAHRVRLTKVEHTFLSEDAINNLGSLKFSQSNRMPDPKDPSRIVTTTTTTTFSMAKDM -LDSHRVRFTKYDHTFTSEEAINNLGSLKFSQSNRMPDPKDPSRIVTTTTTTTFSMAKEM TFEKSKPEQGWQAQIGNIDINDLERVSPLAHRFFTNPDSESHTQYYVSNAGIRLFENKTF ... GLVGVKMAKERKINDKIYMNTFTGK-AAVDWLMDCSTTIERRETVLIAELFVKYGLITML GFSQDMLISSSNLNKLDYVLTDPGMRYLFRRHLEKELCVENLDVFIEIKRFLKKMTILKK Rgs1 Cprgs-1 FlbA Sst2 467 272 479 466 QQDRSHIQQFPGCQVFQPTKHAIYHMTSKGKDMINGSVPRGRASEGDATHSATHRHG-VA ... RGS1 Figure 21 A rgs1D WT Rgs1 OP Complemented B WT rgs1D Complemented Rgs1 OP _ Figure 22 Inductive Non-inductive _ Figure 23 WT rgs1D Complemented Figure 24 Figure 25 Figure 26 Rgs1 MG00990 MG03146...

Ngày tải lên: 14/09/2015, 09:24

... Figure 28 Inductive Non-inductive _ Figure 29 Figure 30 Inductive Non-inductive _ Figure 31 B A Figure 32 A B Figure 33 A B Figure 34 mgb1D ... WT _ rgs1Dmgb1D magB G183Smgb1D Figure 35 Figure 36 MG010315 MG010105 MG09134 Control: Gamma actin MG03982 MG01173 MG01630 Figure 37 A B ...

Ngày tải lên: 14/09/2015, 09:39

... 8-Br-cAMP 10mM 8-Br-cAMP _ B WT rgs1D Figure 45 Appressorium formation on inductive membrane (%) Appressorium formation on Noninductive membrane (%) WT 89 1.5 mscL∆ 92 mscS1∆ 87 2.5 mscS2∆ 91 mscS3∆...

Ngày tải lên: 14/09/2015, 09:53

... A Traditional Water System Rain B Adopting Rainwater for Garden Irrigation water C Adopting Rainwater for Toilet Flushing use D Adopting Rainwater for Toilet Flushing and Garden Irrigation E Reuse ... savings and stormwater management benefits, but increasing final costing at the same time Using fluctuant rainfall would be confronted with the condition that the marginally effectiveness in ... inlets and outlets and sedimentation in the tank to remove debris and minimize the need for maintenance Rainwater harvesting for toilet flushing and garden watering in residential scope is considered...

Ngày tải lên: 05/09/2013, 09:38

... change, leadership development, and training and mentoring into tangible business improvements For Engines, Systems, and Services the results were unquestionably positive In the year 2002 it ... senior executives, an unwillingness to think rigorously about themselves or their thinking It is not surprising that so many executives decline the invitation to reinvent themselves There is another ... leadership development needs In the LDF prep session, the coaching role is explained, and coaches ask the participants for their permission to “press in and challenge their thinking Each coaching relationship...

Ngày tải lên: 17/10/2013, 23:15

... practice: enabling others to act, challenging the process, inspiring a shared vision, encouraging the heart, and modeling the way These modules include video case studies, dynamic learning activities ... to the group by presenting certificates containing individual rock-climbing photos taken during Session Session 6: Enabling Others to Act (11.5 Hours, Split over Days) During this session, participants ... their work at Intel A final debriefing is held in learning groups to discuss key learnings and develop action plans for applying their insights as leaders at Fab 12 Session 8: Inspiring a Shared...

Ngày tải lên: 20/10/2013, 19:15

... Northern Illinois University Janelle Smith is the LDF Program manager with nine years’ Intel experience Prior to Intel, she was a captain in the U.S Air Force, with a B.S in industrial engineering from ... featured on In Search of Excellence with Tom Peters training video (BusinessTrainingMedia.com) 15 Career Systems International (www.careersystemsintl), a Beverly Kaye company, provides career development, ... offers global consulting services and in- house training 11 Ninth House and Instant Advice are trademarks of Ninth House, Inc Innovation: WOW! ProjectsTM (and Capturing Brand YouTM are trademarks of...

Ngày tải lên: 20/10/2013, 19:15

... enabled LMTAS to win the largest contract in their industry’s history—and to remain a force in the aeronautics industry BACKGROUND When Dain Hancock was named company president in 1995, it appeared ... limping along with 1970s vintage manufacturing technology— not surprising, since the plant had suffered from a lack of capital investment for several years During the tenuous early 1990s in the ... be dying before they left the drawing board 243 244 BEST PRACTICES IN LEADERSHIP DEVELOPMENT AND ORGANIZATION CHANGE SHAPING THE FULCRUM BY DEFINING CRITICAL BEHAVIORS Hancock began attacking...

Ngày tải lên: 24/10/2013, 17:15

... responsibility for in uencing new behaviors by having them assume the role of “teacher” Enlisting informal opinion leaders in leading change by identifying them, listening to them, and involving them in strategic ... for supporting culture change activities, but instead for achieving measurable changes in critical behaviors Lockheed Martin leaders gained leverage for in uencing 12,000 others by Enabling formal ... important impact of opinion leaders is not in the headlines, it’s in the cafeteria lines Opinion leaders reach into every conversation, every meeting, and every decision made in an organization...

Ngày tải lên: 24/10/2013, 17:15

... halves of the brain by using music embedded with binary beats Finally, a twelve-by-forty-foot pushpin wall was installed, as well as floor-to-ceiling chalkboards These would serve as living journals ... The organization initiated a re-occurring product development process involving employees from all areas of the company, which is centered on the concept of living systems within a theatrical ... participated in many reengineering processes Mattel already dominated most of the traditional toy categories It was clear that in order to keep growing, Mattel needed to start looking for new...

Ngày tải lên: 29/10/2013, 00:15

... sightings of cubicle walls being taken down, dialogues replacing meetings, stories being told, and gifts being given every day The appreciation of intuition and the ability to read patterns in ... This was structured in three phases: partnering, building, and testing The face-to-face meetings became an essential part of their project planning, and the concept of “stewarding” was implemented ... such as an inspirational saying or drawing to record their participation in the larger story • Building The team partnered with engineers to help them cost products and build prototypes In the spirit...

Ngày tải lên: 29/10/2013, 00:15

... artist, Ross’s innovative metal work in jewelry is in the permanent collection of twelve international museums, including the Smithsonian in Washington D.C., the Victoria and Albert Museum in London, ... fifteen years in the design and entertainment fields His education is in design, engineering, and theater Before joining Mattel, Kuehler was director, creative development and programming for Robert ... has proved valuable in guiding the ongoing efforts to design training and development initiatives for regional manager leadership Key elements of this additional information include • Specific examples...

Ngày tải lên: 07/11/2013, 23:15

... earlier in the year • Providing participants with information on how to use the in- house resources for competency development and link it to the kinds of personal development needs identified in this ... Having learned the importance of and practicing better listening skills, particularly when working in groups (for example, allowing others to express their opinions, understanding before reacting) ... heightened by gathering and including 360degree feedback to supplement the data gathered in the interview conducted by individual assessors (this suggestion has since been implemented) In addition,...

Ngày tải lên: 07/11/2013, 23:15

... Continues Training Methodologies and Tools Leading Indicators of Performance Behavioral and Attitudinal Changes Significant Shifts in Organizational Practices 314 315 315 316 316 317 318 318 INSIGHTS ... confident in the company and their own ability, that confidence cannot result in the perception that others can’t and aren’t doing things better than we are In fact, in healthy companies, innovation ... assessment, individual leadership coaching, and competency modeling Over the past twenty years he has consulted to a diverse group of clients and senior executives in businesses ranging in size and...

Ngày tải lên: 07/11/2013, 23:15