mái tháp gọi là swarloka tượng trưng cho thế giới thần linh nơi chư thần tụ tập 5

Tổng hợp một số bài báo tiếng Anh hay (T112013 đến T82014)

Ngày tải lên : 27/08/2014, 20:15

... of 65 countries and economies as a pleasant “surprise.” The PISA scores, as they are known, measured how a half-million students from randomly selected schools answered written and multiple-choice ... disadvantaged Vietnamese students drop out of school The World Bank reports that in 2010 the gross enrolment rate at upper-secondary schools in Vietnam was just 65% , compared with 89% and 98% in America ... the cabinet she chose contained a surprise: Germany’s new defence minister will be Ursula von der Leyen, the first woman in that job Mrs von der Leyen (centre, above), who at 55 is four years...

116
1.5K
13

Báo cáo khoa học: "Is there a place for N-acetylcysteine in the treatment of septic shock" pptx

Ngày tải lên : 12/08/2014, 20:20

... Nemoto EM: Hepatic dysoxia commences during O2 supply dependence J Appl Physiol 1992, 72:1499- 150 5 Zhang H, De Jongh R, De Backer D, Cherkaoui S, Vray B, Vincent JL: Effects of alpha- and beta-adrenergic ... on hepatosplanchnic perfusion and oxygen extraction in endotoxic shock Crit Care Med 2001, 29 :58 1 -58 8 Riedemann NC, Guo RF, Ward PA: The enigma of sepsis J Clin Invest 2003, 112:460-467 Zhang ... of cytokines in SIRS general medical patients Cytokine 2001, 15: 232-236 Chandel NS, Schumacker PT: Cellular oxygen sensing by mitochondria: old questions, new insight J Appl Physiol 2000, 88:...

3
469
0

Tài liệu [ Team LiB ] Using Contacts for Mail Merge Mail merge is possibly the most popular reason pptx

Ngày tải lên : 21/01/2014, 02:20

... by choosing Tools, Letters and Mailings, Mail Merge Step through the Mail Merge Wizard, choosing Outlook as your data source in step Choose Select from Outlook's Contacts, and then click Choose ... document type to which you're going to merge Your choices are form letters, mailing labels, envelopes, and catalog Select the merge format you want to use, choosing from new document, printer, and email ... 2 If you selected a group of contacts before choosing mail merge, Only Selected Contacts is enabled Choose All Contacts in Current View if you created a filtered view containing...

5
363
0

Tài liệu This material is from the Council for Economic Education docx

Ngày tải lên : 20/02/2014, 19:20

... Privileges the Money Will Buy Step 4: Determine How to Distribute Items and Privileges Step 5: Do It! 35 Step 1: Design the Classroom Money The production and consumption of goods and services ... passes Extra recess period Cleaning the chalkboards Choosing recess activities Time on the computer Writing on the chalkboards Helping the school secretary Buy back a “no name” paper Although ... (especially lunch with the teacher) will remain popular throughout the school year, students often like the tangible items best As the school year progresses, several of the more mundane “privileges”...

14
467
0

Carole martin perfect phrases for the perfect interview (2005)

Ngày tải lên : 16/03/2014, 08:23

... Supervisors Supervising Others 154 Handling Personnel Problems Follow-Through 157 Initiating 159 Problem Solving 161 153 155 Part Four: Final Preparations 163 Chapter Eight: Exercises for the Perfect ... Managers 1 45 Decision Making 146 Delegation 148 Motivating Others 149 Communication Style 151 Ability to Influence Others 152 Chapter Seven: Perfect Phrases for Supervisors Supervising Others 154 Handling ... 41 Strengths 44 Uniqueness 47 Chapter Three: Skill Sets Creativity 51 Communications 54 Strategic Thinking 57 Assertiveness 59 Negotiations 62 Problem Solving 64 Analysis 67 Adaptability 70 Ability...

192
608
0

how to cheat at configuring open source security tools - the perfect reference for the multitasked sysadmin

Ngày tải lên : 25/03/2014, 11:23

... 1 35 139 143 150 156 179 256 - 259 264 389 396 427 443 4 45 457 4 65 512 -51 5 52 4 54 0 56 3 58 7 59 3 636 691 799 900-901 1024-1031 1080 1100 1214 1243 1313 1 352 1433 1494 1498 152 1 152 4- 152 5 152 9 154 1 ... 154 2 1720 1723 17 45 1 755 1813 1944 2000 2001 2003 2049 2080 2140 2301 2447 2766 2779 2869 2998 3128 3268 3300 3306 3372 3389 4000 4001 4002 40 45 4321 4444 46 65 4899 50 00 52 22 55 56 56 31 56 32 56 78 ... 191 192 256 260 407 4 45 500 51 4 52 0 10 35 1037 1041 1 058 1060 1091 1 352 2049 2140 2161 2301 23 65 2493 2631 4802 56 31 56 32 11487 31337 TCP ports 11 13 15 19 21 22 23 25 43 49 53 66-68 70 79 80 81...

530
542
0

Báo cáo khoa học: Unique proteasome subunit Xrpn10c is a speciﬁc receptor for the antiapoptotic ubiquitin-like protein Scythe docx

Ngày tải lên : 30/03/2014, 11:20

... ) IP: anti-Flag 36 23 57 (2 + + -3 Flag-Xrpn10c 15 - (2 x T7-Scythe (2 15 -4 36 ) ) B + + + + T7-Scythe (2 15- 436) 36.1 - ( 257 -436) 25. 3 19.0 - Blot anti-T7 (324-436) * (2 15- 323) 14.7 Blot: anti-Flag ... 10c-specific region Xrpn10c 196 241 263 307 322 355 C Xrpn10c Rrpn10c Mrpn10c 10c-box 322- VILPLLFMFPFLFSW WGQGVHLFLVQLDVPLSIA - 355 340- QILIHLGPQPFLPSIS EEGS - 359 328- ALTQPSLTSPAFRSLSFWDQGLSSLAFHKKGLGATEGNT ... and eluted with 50 mm glutathione in 50 mm Tris ⁄ HCl, pH 8.0 The eluted proteins were then dialyzed against buffer A (50 mm Tris ⁄ HCl, pH 7 .5, containing mm dithiothreitol, 150 mm NaCl, 0.1%...

14
279
0

Báo cáo khoa học: UMP kinase from the Gram-positive bacterium Bacillus subtilis is strongly dependent on GTP for optimal activity potx

Ngày tải lên : 31/03/2014, 07:20

... assay (0 .5- mL ﬁnal volume) on an Eppendorf PCP6121 photometer [ 25] The reaction medium contained 50 mM Tris/HCl (pH 7.4), 50 mM KCl, mM MgCl2, mM phosphoenolpyruvate, 0.2 mM NADH, mM ATP, 0 .5 mM ... subtilis with 5, 5¢-dithiobis (2-nitrobenzoic acid) (DTNB) under native conditions Enzyme ( 25 lM in terms of monomer), in 50 mM Tris/HCl (pH 8) containing 100 mM NaCl, was thermostated at 25 °C and ... and the bisubstrate inhibitor P1- (5 adenosyl) P5- (5 -uridyl) pentaphosphate (UP5A) and Mg2+ at 2.2 ˚ A: implications for water-mediated speciﬁcity Biochemistry 35, 9716–9727 Zhou, L., Lacroute,...

9
328
0

perfect phrases for the toefl - writing and speaking sections (2008)

Ngày tải lên : 16/04/2014, 09:20

... Improving Listening Skills 51 Part III The Writing Section 51 53 Chapter Description of Tasks A Independent Task B Integrated Task 55 55 61 Chapter Phrases and Vocabulary for the Writing Section ... Grammar Posttest 147 Appendix II Punctuation A Punctuation Pretest B Punctuation Rules 101 155 155 157 C Punctuation Posttest 162 vii This page intentionally left blank Perfect Phrases for the ... high schools require all students to wear a uniform to school Other schools allow students to wear whatever they want Which policy you think is better and why? 15 seconds preparation time; 45 seconds...

178
451
0

a place for consciousness probing the deep structure of the natural world nov 2004

Ngày tải lên : 11/06/2014, 10:40

... Chalmers Deconstructing the Mind Stephen P Stich The Human Animal Personal Identity without Psychology Eric Olson Minds and Bodies Philosophers and Their Ideas Colin McGinn What’s Within? Nativism ... Rosenberg p cm.—(Philosophy of mind series) Includes bibliographical references and index ISBN 0-19 -51 6814-3 Consciousness Philosophy of nature I Title II Series B808.9.R67 2004 126—dc22 2003063988 ... scope and detail: It ties experience into a theory of the categorical foundations of causation Scholars should see it as an attempt to make a substantial advance in the development of Bertrand...

344
1.3K
0

the mit press wired for innovation how information technology is reshaping the economy oct 2009

Ngày tải lên : 11/06/2014, 12:44

... Periodical publishers 51 1130 Book publishers 51 1140 Directory and mailing list publishers 51 119 51 1191 51 1199 51 12 51 1210 51 2 51 21 51 2110 51 2120 51 213 Other publishers Greeting card publishers ... dollars) 49.2 1998 12.8 7 .5 5.6 6.9 3.9 3.3 4.4 3.1 3.0 0.2 21.1 44.7 1997 15. 1 9 .5 6.9 4.9 2 .5 3.1 6.0 5. 0 2.1 0.2 14.9 5. 3 0.1 54 .0 2.7 4.8 4.1 5. 2 3.9 2.9 3.1 12.9 54 .9 1999 3.0 0.0 104.9 1.3 ... Radio networks 51 5112 Radio stations 51 5120 51 52 51 5210 51 7 Television broadcasting Cable and other subscription programming Cable and other subscription programming Telecommunications 51 7110 Wired...

175
365
0

báo cáo hóa học: " TLR3 signaling is either protective or pathogenic for the development of Theiler''''s virus-induced demyelinating disease depending on the time of viral infection" docx

Ngày tải lên : 19/06/2014, 22:20

... http://www.jneuroinflammation.com/imedia/17 354 47902 651 114/supp1.tiff Additional file 2: Figure S2.tif, 9 055 K http://www.jneuroinflammation.com/imedia/121217 954 7 651 1 15/ supp2.tiff ... 5 -GGCTCTCCAGACTTCTGCTC-3’); IFN-β, (5 -CCCTATGGAGATGACGGAGA-3’ and 5 -CTGTCTGCTGGTGGAGTTGA-3’); IFN-γ, (5 -ACTGGCAAAAGGATGGTGAC-3’ and 5 -TGAGCTCATTGAATGCTT GG-3’); IL-10, (5 -GCCAAGCCTTATCGGAAATGATCC-3’ and 5 -AGACACCTTGGTCTTGGAGCTT-3’); ... 5 -AGACACCTTGGTCTTGGAGCTT-3’); TNF-α, (5 -CTGTGAAGGGAATGGGTGTT-3’ and 5 GGTCACTGTCCCAGCATCTT-3’); IL-6, (5 -AGTTGCCTTCTTGGGACTGA-3’ and 5 TCCACGATTTCCCAGAGAAC-3’); IL-17, (5 -GGGGATCCATGAGTCCAGGGAGAGC-3’ and 5 -CCCTCGAGTTAGGCTGCCTGGCGGA-3’);...

42
496
0

The IRS Receivables Balance Is Based on Data Maintained for Collection Purpoeee_part1 pdf

Ngày tải lên : 20/06/2014, 06:20

... under the direction of Jeffrey C Steinhoff, Director, Civil Audits, who may be reached at (202) 51 2-9 454 if you or your staff have any questions Other major contributors are listed in appendix II ... Valid Receivables This is trial version www.adultpdf.com Page 16 16 20 22 26 26 27 28 29 30 33 34 35 35 36 39 12 17 GAO/AFMD-93-42 IRS Receivables a Contenta Figure 3.1: Comparison of the IRS and ... gross reported receivables IRS reported balance as of 6/30/91 $104.7 $104.7 Invalid receivables 65. 3 Uncollectible Net collectible receivables $107.0 b (39.4) Subtotal IRS reported balance as of...

11
291
0

The IRS Receivables Balance Is Based on Data Maintained for Collection Purpoeee_part2 potx

Ngày tải lên : 20/06/2014, 06:20

... accounls r~~~:~~ivat~t~~ Junc!30, l!l!tl, was bcl.wc:cn $51 .7 billion and $76 .5 billion as of of ran@ of our corllitlcncc inkrd, at a !t5 pcrccnt confidence Icvcl, is that Ihe acctuat amount of ... population, 95 out of 100 times, the estimate would fall within the confidence interval In other words, the true value is between the lower and upper limits of the confidence interval 95 percent ... allowed us to estimate the value of invalid, valid, uncollectible, and collectible receivables, at a 95 percent confidence level Our projections are expressed as point estimates that fall within confidence...

11
288
0

The IRS Receivables Balance Is Based on Data Maintained for Collection Purpoeee_part3 potx

Ngày tải lên : 20/06/2014, 06:20

... consider the taxpayers’ current ability to pay We estimate that $18.7 billion’ of the estimated $ 65. 3 billion in valid receivables was collectible as of June 30, 1991, while IRSestimated that $28.4 ... Receivables as of September 1991 and June 1991, Respectively Oollrrr In bllllonr 110 100 90 80 70 60 50 40 30 20 10 IRS - GAO Uncollectible Collectible Estimating Collectibility Requires Both Analysis...

11
319
0

The IRS Receivables Balance Is Based on Data Maintained for Collection Purpoeee_part4 pptx

Ngày tải lên : 20/06/2014, 06:20

... confidence interval, at a 95 percent confidence level, is that the actual amount of uncollectible accounts rccrivablc as of June 30, 1991, was between $33.8 billion and $57 .6 billion “Internal Revenue ... Ertimating Collectibility 10 Not Reliable We estimate that $46.6 billion,3 more than two-thirds of the $ 65. 3 billion that we estimated to be valid receivables, were uncollectible About 98 percent of the ... efforts as part of our ongoing financial audit of IRS This is trial version www.adultpdf.com Page 35 GAO/AF’ MD-93-42 IRS Receivables Appendix I Comments From the Internal Revenue Service Note: GAO...

11
229
0

no hiding place for the irresponsible business ppt

Ngày tải lên : 29/06/2014, 14:20

... nước phát triển, làm cho thiết bị cho máy tính công ty viễn thông Lĩnh vực tài chịu nhiều áp lực cho vay dự án gây tranh cãi giới phát triển Trong tháng sáu, nhóm ngân hàng hàng đầu giới, bao gồm ... rõ ràng cho nhóm áp lực kiện tụng, công ty mẹ hai Kraft Foods Philip Morris Ngành công nghiệp mà tránh ý tìm kiếm ý tập trung vào chúng vận động bắt đầu cho thấy quan tâm đến điều kiện làm việc ... USD Tổng người 17 giàu giới, theo Forbes, tạp chí Mỹ Khái niệm đằng sau thành công tuyệt vời Ikea tin đơn giản làm cho giá phải chăng, đồ nội thất thiết kế tốt có sẵn cho công chúng Và sau ông...

12
1.1K
0

Perfect Phrases for the TOEFL potx

Ngày tải lên : 28/07/2014, 22:20

... Improving Listening Skills 51 Part III The Writing Section 51 53 Chapter Description of Tasks A Independent Task B Integrated Task 55 55 61 Chapter Phrases and Vocabulary for the Writing Section ... Grammar Posttest 147 Appendix II Punctuation A Punctuation Pretest B Punctuation Rules 101 155 155 157 C Punctuation Posttest 162 vii This page intentionally left blank Perfect Phrases for the ... high schools require all students to wear a uniform to school Other schools allow students to wear whatever they want Which policy you think is better and why? 15 seconds preparation time; 45 seconds...

179
228
1

Perfect matchings for the three-term Gale-Robinson sequences ppsx

Ngày tải lên : 08/08/2014, 01:20

... = 0.8 757 827490 659 50194217 251 , c2 = 1.0841 259 254 73763343779968 , c3 = 0.11498600218640220 350 9006 , c4 = 0.0771 156 34 258 697284328024 , c5 = 1.18039739017674264 255 3 759 , c6 = 1 .50 80308312 650 86447098989 ... L(n, r, c) =0: =1: =2: =3: =4: =5: =6: ½¾ Ì {17, 11, 5, −1, } {16, 10, 4, −4, } {13, 7, 1, 5, } {12, 6, 0, −6, } {9, 3, −3, −9, } {8, 2, −4, −10, } {5, −1, −7, −13, } Ơ Ị ĨỊ the ... ĐỜÝ the electronic journal of combinatorics 16 (2009), #R1 25 19 P (4) = P (5) = P (6) = P (7) = E P (5) = P (4) P (8) = P (6)E = P (5) P (9) = P (8)N = P (8)S = P (6) ÙƯ ½½ Ê ÙƯ× Ú × ÕÙ Ị º Ø...

38
182
0

Perfect matchings for the three-term Gale-Robinson sequences pdf

Ngày tải lên : 08/08/2014, 01:20

... = 0.8 757 827490 659 50194217 251 , c2 = 1.0841 259 254 73763343779968 , c3 = 0.11498600218640220 350 9006 , c4 = 0.0771 156 34 258 697284328024 , c5 = 1.18039739017674264 255 3 759 , c6 = 1 .50 80308312 650 86447098989 ... L(n, r, c) =0: =1: =2: =3: =4: =5: =6: ½¾ Ì {17, 11, 5, −1, } {16, 10, 4, −4, } {13, 7, 1, 5, } {12, 6, 0, −6, } {9, 3, −3, −9, } {8, 2, −4, −10, } {5, −1, −7, −13, } Ơ Ị ĨỊ the ... ĐỜÝ the electronic journal of combinatorics 16 (2009), #R1 25 19 P (4) = P (5) = P (6) = P (7) = E P (5) = P (4) P (8) = P (6)E = P (5) P (9) = P (8)N = P (8)S = P (6) ÙƯ ½½ Ê ÙƯ× Ú × ÕÙ Ị º Ø...

38
225
0