improve opinion target identification
Tài liệu Báo cáo khoa học: Identification of GAS-dependent interferon-sensitive target genes whose transcription is STAT2-dependent but ISGF3-independent doc
Ngày tải lên :
19/02/2014, 07:20
... (2006) 1569–1581 ª 2006 The Authors Journal compilation ª 2006 FEBS 1577
Identification of GAS-dependent interferon-sensitive target
genes whose transcription is STAT2-dependent but
ISGF3-independent
Melissa ... followed by identification of the most
differentially regulated genes. Finally, these genes were
validated by real-time PCR and placed into the context
of IFN-related biological pathways.
Target gene ... down-regulation of a substantially larger subset of
genes.
Identification and characterization of a subset of
ISGF3-independent STAT2-dependent target
genes
To identify those genes whose expression...
- 13
- 459
- 0
Tài liệu Báo cáo khoa học: Identification of Ewing’s sarcoma protein as a G-quadruplex DNA- and RNA-binding protein ppt
Ngày tải lên :
15/02/2014, 01:20
... APKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGP
GGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPP
GPLMEQMGGRRGGRGGPGKMDKGEHRQERRDRPY
K. Takahama et al. Identification of Ewing’s sarcoma protein
FEBS Journal 278 (2011) 988–998 ª 2011 The Authors Journal compilation ª 2011 FEBS 991
Identification of Ewing’s sarcoma ... Oxytricha
telomere-binding protein promotes G-quartet formation
by telomeric DNA. Cell 74, 875–885.
Identification of Ewing’s sarcoma protein K. Takahama et al.
996 FEBS Journal 278 (2011) 988–998 ... labeled
DNA. The DNA–protein complexes were resolved by 6% PAGE
and visualized by autoradiography.
Identification of Ewing’s sarcoma protein K. Takahama et al.
992 FEBS Journal 278 (2011) 988–998...
- 11
- 786
- 0
Tài liệu Báo cáo khoa học: Identification and characterization of the transcription factors involved in T-cell development, t-bet, stat6 and foxp3, within the zebrafish, Danio rerio docx
Ngày tải lên :
16/02/2014, 09:20
... which binds phosphorylated tyrosine residues
in the context of a longer peptide motif within a target
protein [38,39]. Within zebrafish stat6, there is good
conservation of the protein sequence ... bootstrap. Evolution 39, 783–
791.
80 Nielsen H, Engelbrecht J, Brunak S & vonHeijne G
(1997) Identification of prokaryotic and eukaryotic
signal peptides and prediction of their cleavage sites.
Protein ... 169–182.
84 Zou J, Carrington A, Collet B, Dijkstra JM, Yoshiura
Y, Bols N & Secombes C (2005) Identification and
bioactivities of IFN-gamma in rainbow trout Oncorhyn-
chus mykiss: the first Th1-type...
- 20
- 689
- 0
Tài liệu Báo cáo khoa học: The cellulosomes from Clostridium cellulolyticum Identification of new components and synergies between complexes ppt
Ngày tải lên :
18/02/2014, 08:20
... xylanase F1 fraction combined with either the
Table 1. Identification of specific components detected in fractions F1, F5 and F6 using MS analysis. All identifications were based on pep-
tide mass fingerprint ... acquisition.
Maximum coverage identification was carried out using the
big three program included in the data acquisition Xcali-
bur
Ô
Finnigan proteomex 2.0 software program. Protein
identification was performed ... Nucleic Acids Res 34, 247–251.
48 Dyrlov Bendtsen J, Nielsen H, von Heijne G & Brunak
S (2004) Improved prediction of signal peptides: SignalP
3.0. J Mol Biol 340, 783–795.
Supporting information
The...
- 11
- 599
- 0
Tài liệu Báo cáo khoa học: Identification of two late acyltransferase genes responsible for lipid A biosynthesis in Moraxella catarrhalis doc
Ngày tải lên :
18/02/2014, 14:20
... antisense) [19]
Identification of M. catarrhalis lpxX and lpxL S. Gao et al.
5206 FEBS Journal 275 (2008) 5201–5214 Journal compilation ª 2008 FEBS. No claim to original US government works
Identification ... amplification of target genes
ats, lpxX and lgt6 in cDNA samples were ats1 ⁄ ats2,
b1SP ⁄ b1AP, and lg1 ⁄ lg2, respectively (Table 2, Fig. 1A).
Primer sets for PCR amplification of target genes atr, ... segments. Biol Chem
Hoppe-Seyler 374, 166 .
44 Claros MG & von Heijne G (1994) TopPred II: an
improved software for membrane protein structure pre-
dictions. CABIOS 10, 685–686.
45 Rost B, Yachdav...
- 14
- 674
- 0
Tài liệu Báo cáo khoa học: Identification and characterization of an R-Smad ortholog (SmSmad1B) from Schistosoma mansoni pdf
Ngày tải lên :
18/02/2014, 16:20
... this
study, we report the identification of SmSmad1B
cDNA and present its gene structure along with the
expression profiles, immunolocalization, and protein
interaction properties.
Results
Identification of ... levels by approximately 45% in the
later stages (35 days or older) of mammalian develop-
ment [6].
Identification and immunolocalization of
SmSmad1B protein in adult schistosomes
To detect the native ... 8),
as the functions of these Smads in other organisms are
highly redundant. Future analysis of the target genes
activated by the BMP-related Smads from schisto-
somes will aid in differentiating...
- 19
- 653
- 0
Tài liệu Báo cáo khoa học: Identification, sequencing, and localization of a new carbonic anhydrase transcript from the hydrothermal vent tubeworm Riftia pachyptila docx
Ngày tải lên :
18/02/2014, 16:20
... providing the samples used in this
study. We also thank three referees whose remarks have
considerably improved this paper. Funding for this
project was provided by the Re
´
gion Bretagne (PRIR
Symbiose) ... of
carbonic anhydrase. Mar Biol 100, 195–202.
14 Kochevar RE, Govind NS & Childress JJ (1993)
Identification and characterization of two carbonic
anhydrases from the hydrothermal vent tubeworm
Riftia ... et al.
5316 FEBS Journal 274 (2007) 5311–5324 ª 2007 The Authors Journal compilation ª 2007 FEBS
Identification, sequencing, and localization of a new
carbonic anhydrase transcript from the hydrothermal
vent...
- 14
- 591
- 0
Tài liệu Báo cáo khoa học: Identification of differentially expressed genes of the Pacific oyster Crassostrea gigas exposed to prolonged thermal stress docx
Ngày tải lên :
18/02/2014, 16:20
... equation:
Relative expression ¼½ðE
target
Þ
DC
ttargetðcontrolÀsampleÞ
=
½ðE
ref
Þ
DC
trefðcontrolÀsampleÞ
;
where E
target
is the amplification efficiency of the target or
gene of interest, E
ref
is ... activation of Thermo-StartÒ
DNA polymerase at 95 ° C for 15 min followed by ampli-
fication of the target cDNA (45 cycles of denaturation at
95 °C for 30 s, annealing and extension at 60 °C for
1 ... confirmation.
For gene expression calculation, the threshold value
(Ct) was determined for each target as the number of
cycles at which the fluorescence rose appreciably above
the background fluorescence....
- 11
- 570
- 0
Tài liệu Báo cáo khoa học: Suppressed catalytic efficiency of plasmin in the presence of long-chain fatty acids Identification of kinetic parameters from continuous enzymatic assay with Monte Carlo simulation ppt
Ngày tải lên :
18/02/2014, 17:20
... not
sensitive to the presence of fatty acids (Fig. 8B). These
results preclude the catalytic domain as a target of the
fatty acids and support the notion that interaction
with kringle 5 is sufficient for ... overall catalytic outcome may vary with
the concentration of the substrate.
The approach used for the identification of kinetic
parameters in this study exploited the advantages of
progress curve evaluation ... distribution of the
parameters estimated using this robust evaluation
procedure was essential for the identification of the
statistical significance of the described effects. In con-
clusion, our study...
- 9
- 473
- 0
Tài liệu Báo cáo khoa học: Identification of a novel matrix protein contained in a protein aggregate associated with collagen in fish otoliths pdf
Ngày tải lên :
18/02/2014, 17:20
... 483–489.
16 Perkins DN, Pappin DJC, Creasy DM & d Cottrell JS
(1999) Probability-based protein identification by
searching sequence databases using mass spectrometry
data. Electrophoresis 20, ... of the sacculus, by contrast, mRNA hybrid-
ization signals were barely detectable (Fig. 2C,D).
Identification of the calcium-binding domain in
OMM-64
To determine the regions that have calcium-binding
activity, ... framework
FEBS Journal 275 (2008) 2512–2523 ª 2008 The Authors Journal compilation ª 2008 FEBS 2515
Identification of a novel matrix protein contained in a
protein aggregate associated with collagen...
- 12
- 568
- 0
Tài liệu Báo cáo khoa học: Direct identification of hydrophobins and their processing in Trichoderma using intact-cell MALDI-TOF MS docx
Ngày tải lên :
19/02/2014, 02:20
... well-known
hydrophobins were suspected to be the signal source,
and some were assigned by database analysis.
Identification of the class II hydrophobins
produced by H. jecorina
In order to identify the already ... highly abundant intracellular
constituents [22]. This set of about 10–30 defined
masses permits the identification at the species and
subspecies ⁄ strain level. We here show that in filamen-
tous fungi, ... ubiquitins. The sensitivity of detection
employing the MALDI-TOF technique can be expec-
ted to allow the identification of bacterial peptides
with 100 microbial cells.
Experimental procedures
Reagents...
- 12
- 632
- 0
Tài liệu Báo cáo khoa học: Identification of b-amyrin and sophoradiol 24-hydroxylase by expressed sequence tag mining and functional expression assay docx
Ngày tải lên :
19/02/2014, 07:20
... cerevisiae yielded olean-12-ene-3b,24-diol. This
is the first identification of triterpene hydroxylase cDNA from any plant
species. Successful identification of a b-amyrin and sophoradiol 24-hydroxy-
lase ... enzymes, it was unex-
pected that CYP93E1 would encode b-amyrin and
sophoradiol 24-hydroxylase. The identification of
CYP93E1 as triterpene hydroxylase implies that the
function of other members of ... saponins has been attempted for
decades, but without practical success so far [4–6]. In
order to improve the biological production method, a
detailed understanding of the biosynthesis of triterpene
saponins...
- 12
- 704
- 0
Tài liệu Báo cáo khoa học: Identification of membrane-bound serine proteinase matriptase as processing enzyme of insulin-like growth factor binding protein-related protein-1 (IGFBP-rP1/angiomodulin/mac25) doc
Ngày tải lên :
19/02/2014, 07:20
... Maile LA & Holly JM (1999) Insulin-like growth binding
protein (IGFBP) proteolysis: occurrence, identification,
role and regulation. Growth Horm IGF Res 9, 85–95.
25 Collett-Solberg PF & Cohen ... Coughlin
SR & Craik CS (2000) Cellular localization of
membrane-type serine protease 1 and identification of
protease-activated receptor-2 and single-chain
urokinase-type plasminogen activator ... Glycobiology 14,
139–146.
35 Shi YE, Torri J, Yieh L, Wellstein A, Lippman ME &
Dickson RB (1993) Identification and characterization
of a novel matrix-degrading protease from hormone-
dependent...
- 13
- 603
- 0
Tài liệu Báo cáo khoa học: Bioinformatics of the glycoside hydrolase family 57 and identification of catalytic residues in amylopullulanase from Thermococcus hydrothermalis doc
Ngày tải lên :
19/02/2014, 12:20
... the proposed conserved sequen ce regions (Fig. 1), our
alignment constitutes a valid base for the identification o f
other f unctional r esidues i n both the present and future
GH-57 members.
Acknowledgements
The ... bonds. The align-
ment and mutagenesis strategy employed by v an Lieshout
et al . [36] allowed the identification of Glu117 as the catalytic
nucleophile (analogous to residue Glu123 in O32462_
THELI ... alignment presented in this
work (Fig. 1). However, with re gard to the catalytic acid-
base, in our opinion these authors misaligned the succee ding
parts of the GH-57 sequences and therefore falsely...
- 10
- 577
- 0
Tài liệu Báo cáo khoa học: What makes biochemical networks tick? A graphical tool for the identification of oscillophores ppt
Ngày tải lên :
19/02/2014, 16:20
... inetic schemes i n terms of dual grap hs [ 21] is different,
and has enabled us t o simplify the identification a nd the
classification of oscillophoretic networks.
Because above we were most concerned ... at it considers positive and negative
interactions in a unified manner.
The implication o f the identification o f an oscillophoretic
subgraph is that if such a subgraph is found in a large
network, ... oscillophores (Eur. J. Biochem. 271) 3879
What makes biochemical networks tick?
A graphical tool for the identification of oscillophores
Boris N. Goldstein
1
, Gennady Ermakov
1
, Josep J. Centelles
3
,...
- 11
- 638
- 0
