genomics discovery and functional analysis of genes

... expression and functional analysis of HD-Zip III genes in angiosperm and gymnosperm forest trees BMC Plant Biology 2010 10:273 Submit your next manuscript to BioMed Central and take full advantage of: ... consolidate the list of candidate targets Future studies could continue to explore and compare more broadly the role of HD-Zip III genes in primary and secondary vascular growth of woody plants, ... Hasebe M: Isolation of homeodomainleucine zipper genes from the moss Physcomitrella patens and the evolution of homeodomain-leucine zipper genes in land plants Molecular Biology and Evolution 2001,...

Ngày tải lên: 11/08/2014, 11:21

... Here we confirm and extend earlier studies of these AAA-peroxins and give a further detailed functional analysis of their cassette structure and interaction The interaction of Pex1p and Pex6p involves ... biological function of Pex1p and Pex6p 51 Domain function of Pex1p and Pex6p I Birschmann et al A B C D E F Fig Effects of point mutation of the WalkerA and B motifs of the AAA-cassettes of Pex1p on ... (D2) of Pex1p and Pex6p are essential for peroxisomal biogenesis To investigate the effects of the described WalkerA and WalkerB mutants of the ATP-binding sites for the function of Pex1p and...

Ngày tải lên: 07/03/2014, 16:20

... (featuring a Km of 3.1 lM and an apparent Vmax of 28.49 lmolÆh)1Æmg)1) and a substrate inhibition curve (featuring a Km of 13.5 lM, an apparent Vmax of 89.47 lmolÆh)1Æmg)1 and a Ksi of 5.65 lM) were ... 0.25 lm) and programmed at an initial temperature of 45 °C for min, with a ramp of 10 °CÆmin)1 to 280 °C, and final time of 10 Products were identified by comparison of retention times and mass ... by random sequencing of a flavedo-derived cDNA library of C limon and their characterization by functional expression in Escherichia coli MATERIALS AND METHODS Plant material, substrate, and reagents...

Ngày tải lên: 08/03/2014, 23:20

... 0.667 [30]) A value of 1.36 was taken for the refractive index n [31] MALDI-TOF analysis MALDI-TOF analysis of the peptides obtained after tryptic digestion of the labeled and nonlabeled Ag-NPA-1 ... incorporation of the ligand Binding of DAUDA to Ag-NPA-1 caused  20% quenching of the emission of Trp17 indicating FRET between the single Trp residue and the dansyl group We calculated a value of 3.74 ... Trp chromophore of ABA-1, the single Trp of Ag-NPA-1 is a sensitive marker of the protein conformation and its emission reflects conformational changes after ligand binding Analysis of FRET from...

Ngày tải lên: 16/03/2014, 18:20

... FEBS 1867 Analysis of upstream region of the Pokemon gene Y Yang et al decoy experiments using lg of the NEG-U decoy, lg of the NEG-D decoy, and a combination of lg each of the NEG-U and NEG-D ... different constructs in A549 and DU145 cells (C) The effects of lg of the NEG-U decoy, lg of the NEG-D decoy and a combination of lg of each decoy on the activity of F-560 The open ellipse indicates ... indicated above each lane (B) Activities of F-233 and MF-233 in A549 and DU145 cells (C) Activities of F-233 and varying amounts of the decoy oligonucleotides in A549 and DU145 cells WP-decoy indicates...

Ngày tải lên: 30/03/2014, 04:20

... residues of D3 and B contribute to the stability of the dimer The first cluster includes F70/V336 and I72/Q338 (both in b5 strand) of D3 and F27/Y289 (b2 strand), L67/M324, V70/I327 and L72/L328 ... b5 strand) of D3 and I41/L304, C43/A306 (both in b3), L69/S326 and L71/L328 (both in b4) of B Stacking interactions between guanidinium groups of arginines R69/V335 of D3 and R25/G287 and R49/T312 ... in b4 strand) of B The second cluster consists of P6/M267, L10/ L271 (both in a-helix), V18/C279 (b1 strand), L32/F293 (b2 strand), I33/K294 (loop after b2 strand), I68/F334, L71/ V337 and L73/F339...

Ngày tải lên: 30/03/2014, 15:20

... Determination of the antigenic phenotype and frequency of subsets of WC1+ and WC1- γδ T cells in peripheral blood and lymphoid tissues: i) Flow cytometric analysis: Analysis of the tissue distribution of ... expression of WC1N3 and WC1-N4 isoforms and expression of families of the γδ TCR that express determinants TCR1-N6, TCR1N7, or TCR1-N6 and -N7 Only a subset of WC1- γδ T cells expressed a form of TCR1 ... pattern of expression of TCR1N6+ and TCR1-N7+ cells also suggested expansion of the WC1+ population of γδ T cells, in the course of evolution, included selective usage of a subset of TCR1 Vγ, Jγ, and...

Ngày tải lên: 07/08/2014, 14:22

... HIV-1 subtype C RRE genetic and functional characteristics In the present study, we present in-depth genetic and functional analysis of RRE sequences from a cohort of 13 HIV-1 infected individuals ... T7 RNA polymerase and fixed amounts of it was incubated with varying amounts of Rev protein and subjected to EMSA as described earlier [18] Results and discussion Analysis of RRE nucleotide sequences ... Institute of Medical Education and Research (PGIMER), Chandigarh by Dr A Wanchu (Clinician and one of the authors) after obtaining all requisite ethical clearances The clinical features of all the...

Ngày tải lên: 10/08/2014, 05:21

... Structural and functional analysis of hUpf1……………………….41 1.7.1 Previous functional and biochemical studies of Upf1……………… .41 1.7.2 Structural studies of Superfamily helicases……………………………43 1.7.3 Aims of ... STRUCTURAL AND FUNCTIONAL ANALYSIS OF CRITICAL PROTEINS INVOLVED IN mRNA DECAY CHENG ZHIHONG (B.Sc) Ease China University of Science and Technology A THESIS SUBMITTED FOR THE DEGREE OF DOCTOR OF PHILOSOPHY ... assay of Dhh1………………………………… 109 Figure 4-7 In vivo mutagenesis analysis of Dhh1……………………………… 113 Figure 4-8 Analysis of limited trypsin digestion of Dhh1………………………….115 Figure 4-9 Comparison of Dhh1...

Ngày tải lên: 14/09/2015, 22:22

... exist in exon Restriction analysis was performed using 10μl of PCR product, 7μl of dH2O, 2μl of NEB Buffer (10X) and 1μl (10 units/μl) of BstUI (New England BioLabs) and incubated at 600C for ... with 50μl of DNase incubation mix (40μl of yellow core buffer, 5μl of 0.09M MnCl2 and 5μl of DNase I enzyme) and incubated at room temperature (20-25°C) for 15 minutes Immediately 200μl of SV DNase ... creates a unique restriction site and it produces two bands (600bp and 200bp) Three bands (800bp, 600bp and 200bp) will be found in case of heterozygotes 2.4.3 Sequencing of PCR product After detecting...

Ngày tải lên: 15/09/2015, 17:10

... Interactions of recombinant CRP-1 and -2 Comparison of expression efficiencies of rCRP-1 and -2 Interactions of CRPs are enhanced in the presence of calcium, as well as during infection CRP-1 and -2 ... tCRP-2 and tCRP-3, and each consists of several isoforms These exhibit differential binding affinity to various carbohydrate moieties, and have different hemolytic and haemagglutination profiles Of ... several isoforms of CRP-1 and -2 by 5’ and 3’RACE, several of which exhibited silent mutations The differential affinities of the major CRP isotypes to various ligands possibly indicate functional...

Ngày tải lên: 03/10/2015, 20:57

... of the samples and standard dilutions were pipetted in triplicates into wells of a 96-well microtiter plate and incubated with 25 àl of a mixture of solution S and A (ratio 1:50) and 200 àl of ... Co-IP of KLC1 and NCAM from mouse brain lysate 47 Fig 7: Immunofluorescence analysis of a CHO cell overexpressing NCAM and GFP-KLC1/KHC1 48 Fig 8: Immunofluorescence analysis of ... kinesin-1 and kinesin light chain 13 Fig 4: Analysis of the purification fractions and the concentrate of hNCAM180ID 41 Fig 5: Analysis of the purification fractions and the concentrate of hNCAM140ID...

Ngày tải lên: 25/11/2015, 13:27

... or FRBGL1 and FRBGL3, based on the conserved sequences of dtxR homologous genes [1], and the DNA of S coelicolor as template PCR products of 313 bp and 451 bp were obtained with each of the above ... disappears and is converted into protein P6, which accumulates Discussion The finding of two dmdR genes similar to the dtxR gene of C diphtheriae [18,19], the dmdR genes of C lactofermentum [7,8] and ... analyzed by using the mascot software [29] F J Flores et al Immunodetection analysis of DmdR1 and DmdR2 Western blot analysis of DmdR1 and DmdR2, after SDS ⁄ PAGE resolution of the proteins, was performed...

Ngày tải lên: 16/03/2014, 18:20

... limited to GA and LFY, activate both B (PI and AP3) and C (AG) class genes Both classes of genes retain organ identity functions as described in the ABC model Mutations in the B class genes, notated ... genomic sequences of the spinach genes SpPI and SpAP3 This file contains the sequences of the PCR primers used to amplify sequential, overlapping fragments of the genes SpPI and SpAP3 Authors' ... silencing and in situ hybridization experiments, interpreted the data and contributed to the design of the project and to the writing of the manuscript MJ executed the genetic sequencing and analysis...

Ngày tải lên: 12/08/2014, 03:21

... gene, and the essence of most of the conserved amino acids has been further substantiated by site-directed mutagenesis of FHT [7,9] and by documentation of ligand binding in crystalline DAOCS and ... not been functionally proved and the lability of substrate and product rule out any cocrystallization The setting of a helices and b-strands causes very similar CD spectra for this class of enzymes ... site of isopenicillin N synthase: genetic and sequence analysis of the endogenous ligands Biochemistry 35, 1981–1987 Durairaj, M., Leskiw, B.K & Jensen, S.E (1996) Genetic and biochemical analysis...

Ngày tải lên: 21/02/2014, 03:20

... region of FnBPB shows functional organization and immunological features of the homologous domain of FnBPA Second, the epitopes recognized by 15E11 are localized to repeats and 10 of both FnBPA and ... FnBRs of FnBPB A panel of mouse mAbs was produced against the recombinant repetitive region of FnBPB Analysis of mAbs binding to the recombinant FnBR indicated the generation of two categories of ... conservation of structural and functional features of the Fn-binding moieties of FnBPA and FnBPB NYQFGGHNSVDFEEDTLPQVSGHNEGQQTIEEDTTP High-affinity binding sites for full-length Fn and its N-terminal...

Ngày tải lên: 06/03/2014, 22:21

... cHx cHx cHx A B Fig PAGE analysis of CF-expressed ETB fragments on SDS gels (A) CF expression of ETB fragments in the presence of Brij78; 0.7 lL of supernatant (S) and lL of eluate (E) after Ni–chelate ... after SDS ⁄ PAGE analysis Protein bands corresponding to dimers or even higher oligomers of full-length ETBcHx and of most of the truncated derivatives are visible after separation of purified protein ... functions of ETB: the binding of ET-1 as one of the main natural peptide ligands, and ETB dimerization This close colocalization raises the question of whether dimer formation could modulate the ligand-binding...

Ngày tải lên: 16/03/2014, 10:20

... nucleotide sequence, as well as a systematic structural and functional analysis of the 5¢ flanking region of the Bsep gene The 5¢ deletional analysis of the Bsep promoter revealed a region from nucleotide ... with bile acids and assays of promotor activities were carried out as in (A) *P < 0.05 Fig Functional analysis of the Bsep promotor in cell lines The constructs p-1453, p-187, p-126 and p+80–1453 ... sequence of the first FXRE Ó FEBS 2002 3500 T Gerloff et al (Eur J Biochem 269) Fig Decrease of basal activity and loss of CDCA-mediated stimulation of the minimal Bsep promoter after mutation of the...

Ngày tải lên: 17/03/2014, 23:20

... Analysis of Genes and Genomes Richard J Reece University of Manchester, UK John Wiley & Sons, Ltd Analysis of Genes and Genomes Analysis of Genes and Genomes Richard J Reece University of ... at The University of Manchester I thank the many of them who read parts of the manuscript, and all of them for challenging me, and many of my preconceived ideas Judith, Daniel and Kathryn have ... pairing (A to T and G to C) holds the two strands of the helix together DNA replication occurs through the unwinding of the DNA strands and copying each strand The central dogma of molecular biology:...

Ngày tải lên: 03/04/2014, 12:05

... the analysis and modeling of physiological signals, tools for the structured discovery of diagnostic markers, prototypical representations of biological activity, and the efficient detection of ... presence of additive noise and make the technique more sensitive to variations in length The combined use of Max-Min clustering and a fuzzy preclustering phase allows the analysis of large amounts of ... separation of clusters, and the original signal is replaced by the corresponding sequence of symbols The symbolization process allows us to shift from the analysis of raw signals to the analysis of sequences...

Ngày tải lên: 22/06/2014, 23:20