equations of the form b k •••••••••• dt f

Structure and rheology of mixtures of the protein b lactoglobulin and the polysaccharide k carrageenan

... has been the subject of a wide range of biophysical studies because of its abundance and ease of isolation from milk Its biological function is not clear, but it is a member of the lipocalin family ... 5°C The red line indicates the temperature of the sample The observed effects of adding KCl can be explained as follows In the absence of KCl, the coil-helix transition needs to be induced by ... KCl concentrations At 10mM and 15.3mM CaCl2 gelation was already observed in the absence of KCl (figure 3.5), but again addition of KCl led to faster gelation and stiffer gels The effect of KCl...

Ngày tải lên: 12/07/2015, 13:00

131 272 0

Ngoại Ngữ
» Tổng hợp

Structure and rheology of mixtures of the protein b lactoglobulin and the polysaccharide k carrageenan

... has been the subject of a wide range of biophysical studies because of its abundance and ease of isolation from milk Its biological function is not clear, but it is a member of the lipocalin family ... 5°C The red line indicates the temperature of the sample The observed effects of adding KCl can be explained as follows In the absence of KCl, the coil-helix transition needs to be induced by ... KCl concentrations At 10mM and 15.3mM CaCl2 gelation was already observed in the absence of KCl (figure 3.5), but again addition of KCl led to faster gelation and stiffer gels The effect of KCl...

Ngày tải lên: 18/07/2016, 20:12

132 289 0

Báo cáo y học: "Study of the early steps of the Hepatitis B Virus life cycle"

... cells but not the rat hepatocytes This binding could be inhibited by recombinant HBs but not by the recombinant LHBs The binding of SHBs with human hepatocytes was further supported by the observation ... to the putative fusogenic domain of HBV suggests that the viral infection probably is the consequence of the exposure of HBV fusion domain (Figure B) [5,6] The proteolysis to make the viral fusion ... investigation was from the kinetic study of the uptake of DHBV by duck primary hepatocyte In 1999, Qiao and his colleagues have performed a kinetic study of DHBV uptake They observed that DHBV DNA appeared...

Ngày tải lên: 03/11/2012, 10:09

13 654 1

Tài liệu Báo cáo khoa học: Limited suppression of the interferon-b production by hepatitis C virus serine protease in cultured human hepatocytes pptx

... performed as described in Fig 1A (B) Effect of NS3-4A on IRF-3 dimerization induced by the ectopic expression of TRIF in PH5CH8 cells The dimerization analysis of IRF-3 was performed as described ... lysate of PH5CH8 cells transfected with the pCX4bsr vector was used as a control (NS–) (A) Effect of NS3-4A on the IFN -b gene promoter activated by T-pIC treatment (B) Effect of NS3-4A on the IFN -b ... as Cardif in PH5CH8 cells First, we conﬁrmed the effect of NS3-4A on the activation of the IFN -b gene promoter by the Cardif exogenously expressed in PH5CH8 cells The results of the luciferase...

Ngày tải lên: 18/02/2014, 16:20

16 524 0

Tài liệu Báo cáo khoa học: Long-distance interactions between enhancers and promoters The case of the Abd-B domain of the Drosophila bithorax complex pdf

... differing in some fundamental way from that formed within the BX-C Conceivably, the normal function of the PTS in iab-7 is to help enhancers bypass the enhancer-blocking activity of the Fab)8 boundary ... reﬂects the difference between the complexities of the regulation of the two systems: a longer time is required for the formation of the complex looping structure in the case of BX-C, FEBS Journal ... in the case of Abd -B by the fact that the chromatin topology of the latter is likely to be different in different segments Hopefully, an increasing number of reporter genes inserted within different...

Ngày tải lên: 20/02/2014, 01:20

7 719 0

Báo cáo khoa học: Functional analysis of the aglycone-binding site of the maize b-glucosidase Zm-p60.1 pot

... F4 61L, F2 0 0K and P2 Furthermore, the F1 93A and W37 3K mutations not result in any change in the thermostability of the enzyme (Table S2), and thermal unfolding of the wild-type and both the F1 93A ... constructed four single (F1 93A, F2 0 0K, F4 61L and W37 3K) mutants and one quadruple (F1 93A F2 0 0K W37 3K F4 61L) mutant introducing features of the consensus motif into the Zm-p60.1 scaffold, then subjected ... masses of $ 110 and $ 43 kDa, respectively, (Fig 5A ,B and Table S3) The apparent molecular mass of $ 110 kDa is in good agreement with the 118 kDa calculated for the dimeric forms of the enzymes based...

Ngày tải lên: 16/03/2014, 04:20

13 401 0

Báo cáo khoa học: CpG methylation of the CENP-B box reduces human CENP-B binding pptx

... Tanaka et al revealed that the presence of the CENP -B box is essential for the formation of functional minichromosomes [15,16] Therefore, the CENP -B box is required for the formation of a functional ... and of the CENP -B box DNA reduces the CENP -B binding affinity almost to the level of nonspecific DNA binding A Discussion B Fig CpG methylation reduces the affinity between CENP -B and the CENP -B box ... methylation may be a reason for the reduced specificity of CENP -B to the CENP -B box sequence What is the functional meaning of the CpG methylation of the CENP -B box DNA? Recently, a link between centromeric...

Ngày tải lên: 16/03/2014, 18:20

8 497 0

The fabric of the cosmos b greene

... rigid flip book, it will sometin~es useful to think of it as a huge, fresh loaf of bread And in be place of the fixed pages that make u p a book -the fixed Newtonian time slices-think of the varlet> ... a peak of one wave and a peak of the other cross, the height of the water is even greater, being the sum of the hvo peak heights Sinilarly, when a trough of one wave and a trough of the other ... cases, the part of the probability wave left out of Figure 4.5 (the part extending throughout the rest of the universe) looks very much like the part near the edges of the figure: quite flat and...

Ngày tải lên: 17/03/2014, 14:04

289 244 0

Báo cáo khoa học: Direct CIII–HﬂB interaction is responsible for the inhibition of the HﬂB (FtsH)-mediated proteolysis of Escherichia coli r32 by kCIII docx

... respect, r32 resembles kCII Inhibition of H B- mediated proteolysis of r32 by CIII and by CIIIC The effect of CIII and CIIIC on the H B- mediated proteolysis of r32 was checked by treating r32-C-his ... does it apply only for CII? We examined the mode of the inhibitory action of CIII on proteolysis of the heat shock sigma factor r32, another substrate of H B Like proteolysis of CII, r32 proteolysis ... stopped by the addition of mm EDTA and SDS ⁄ PAGE loading buffer, followed by heating in a boiling water-bath for The amount of r32 that remained after proteolysis was analyzed after SDS ⁄ PAGE of the...

Ngày tải lên: 23/03/2014, 10:20

6 454 0

Báo cáo khoa học: Mechanism for transcriptional synergy between interferon regulatory factor (IRF)-3 and IRF-7 in activation of the interferon-b gene promoter docx

... C2-regions of CBP Thus, the bulk of the interaction between NF-jB and p300/CBP is mediated by the p65 subunit through the N- and C-terminal regions of the coactivators The pattern of IRF-1 binding ... greater if the virus-activated IRF-3/7 proteins could be used instead of the mutant forms, not only because of the difference in afﬁnity for DNA, but also for the coactivators Nevertheless, the observation ... combinations of factors was investigated (Figs and 6) We ﬁrst tested the effects of ATF-2/ c-Jun, IRF-1, IRF-3/IRF-7 and NF-jB (p50/p65), in the presence or absence of mammalian p300/CBP, on the...

Ngày tải lên: 23/03/2014, 13:20

11 487 0

Báo cáo khoa học: Interactions of the antimicrobial b-peptide b-17 with phospholipid vesicles differ from membrane interactions of magainins potx

... provides a measure of the average effect of the b- peptide on the curvature properties of the lipid measurements were performed in mL of buffer composed of 10 mM Hepes, 0.14 M NaCl, mM EDTA, pH 7.4, ... If b- 17 promoted the formation of a similar pore arrangement, but the diameter of the pore were smaller than that of magainin, then the negative curvature in the dimension around the rim of the ... in the form of LUVs delivered from a motor-driven syringe The reference cell contained the same buffer as the solution placed in the cell A buffer composed of 10 mM Hepes, 0.14 M NaCl, mM EDTA...

Ngày tải lên: 31/03/2014, 07:20

9 266 0

Báo cáo Y học: Barley a-amylase Met53 situated at the high-affinity subsite )2 belongs to a substrate binding motif in the bfia loop 2 of the catalytic (b/a)8-barrel and is critical for activity and substrate specificity pot

... QNDANDVVPNS-DANQNYWGYMTENYFSPDR FATINYSGVTN TAYHGYWARDFKKTNP GDRGF -APADYTRVDAAFGDW ASSDK -SFLDAIVQNGYAFTDRYDIGY VSSEDG SFLDSIIQNGYAFEDRYDLAM SSGDTNYGGMSFLDSFLNNGYAFTDRYDLGF KCPEG KSDGGYAVSSYRDVNP ... indicated by the effect on Cl-PNPG7 (Table 2) for which kinetic parameters were not determined due to the high Km and/or low kcat or for both reasons The rate of product release was 8% of that of wild-type ... presumably stemmed from a dominating loss of rate of catalysis as suggested by the kinetics properties of these mutants on amylose DP17 and Cl-PNPG7 (Table 3) Most remarkably binding of PNPG6 at subsites...

Ngày tải lên: 31/03/2014, 08:20

14 557 0

Báo cáo toán học: "A Presentation of the Elements of the Quotient Sheaves Ωk /Θk in Variational Sequences" pdf

... decomposition k r ∗ πr+1,r ρ = ρ0 + ρ1 + · · · + k We denote by pk : k → k the morphism of sheaves deﬁned by pk ρ = ρq , r,q r r+1 r,q for ≤ q ≤ k k = ker pk , ≤ k ≤ n, is the sheave of contact k- forms ... r,0 r(c) k = ker pk r ,k n , n + ≤ k ≤ N , is the sheave of strongly contact k- forms r(c) Let k = d k 1 + k In [3] and [5] the authours proved the softness of r r(c) r(c) the sheaves k , considered ... = pk r,0 for all ≤ k ≤ n and for all k ∈ Ωr This is the horizontal component of k -form Let ≤ k ≤ n − and ∈ k , then r [ ] = fi1 ···ik dxi1 ∧ · · · ∧ dxik , (2) k! where fi1 ik are some functions...

Ngày tải lên: 06/08/2014, 05:20

11 314 0

Báo cáo toán học: "A reﬁnement of the formula for k-ary trees and the Gould-Vandermonde’s convolution" pps

... colored leaf will be called the candidate leaf • The second class consists of the rest of trees, i.e., the trees in which there is no colored leaf in the lowest level (the level furthest to the root) ... classes of inverse relation [6, p.52] n bn = k= 0 m + ak n k z ak , an = n k n k= 0 −ak − m −an − m bk z n k , −an − m n k (9) we obtain Corollary 3.6 For n > 0, n (−1)n Cβ,γ (n) = k= 0 (1 − β )k − α ... paper of Bajunaid et al [1, 2005] They claimed that they did not ﬁnd their result in the literature and they did not know any obvious combinatorial proof for their special case, even for (1) But,...

Ngày tải lên: 07/08/2014, 15:23

9 242 0

Báo cáo lâm nghiệp: "Influence of the form of nitrogen nutrition reductase activity in young black locus" doc

... Effect of nitrate of leaf NR activity of nodulafed plants Administration of mM NaN0 to 11 mo old nodulated plants did not increase leaf NR activity, whereas the 10 mM NaN0 dose ... activity (Fig 2) After 72 h of induction, the highest NR activity was found in the apical fully expanded leaf and corresponded with the highest nitrate content (Table I) When a new leaf expanded, the ... in the previous leaf and the highest enzyme activity was found again in the new leaf (Fig 2) When the nitrate supply was withdrawn, the enzyme activity recovered its minimum value after d (Fig...

Ngày tải lên: 09/08/2014, 04:20

4 202 0

Báo cáo y học: " Reconstitution of the adult B cell repertoire after treatment with rituximab" pptx

... nonquantitative nature of the bulk PCR approach employed by the investigators Furthermore, for most of the study total B cells were studied without differentiating specific B cell subsets This situation ... Research & Therapy October 2005 Vol No Sanz and Anolik points after treatment Some limitations of the work should be borne in mind, prominently the small number of patients studied and the nonquantitative ... provocative aspect of the study by Rouzière and coworkers [1] is the finding that even CD27– B cells exhibited a level of somatic hypermutation that was substantially higher than expected for either naïve...

Ngày tải lên: 09/08/2014, 07:20

2 231 0

Báo cáo y học: "Baicalein inhibits IL-1β- and TNF-α-induced inflammatory cytokine production from human mast cells via regulation of the NF-κB pathway" pot

... Figure 4analysis of effects of BAI on the gene expression of IL-6, IL-8, and MCP-1 in IL-1β- and TNF-α-activated HMC-1 cells RT-PCR RT-PCR analysis of effects of BAI on the gene expression of ... translocation of NF- B was analyzed by the EMSA using the nuclear fraction Seven micrograms of nuclear protein were added to ml of binding buffer (Promega, Madison, WI), and 35 fmol of double stranded NF- B ... Kwon YK, Shin SW, Kim SC, Choi YH, Park JW, Kwon TK: Differential inhibitory effects of baicalein and baicalin on LPS-induced cyclooxygenase-2 expression through inhibition of C/EBPbeta DNA-binding...

Ngày tải lên: 13/08/2014, 13:22

10 207 0

geography of the world b

... distributed More than 80 percent of the people live in the provinces of Punjab and Sind, on the fertile floodplains of the rivers The flat, fertile plains of the Punjab form the farming heartland of ... reserves off the coast of Sarawak The country is the world’s top producer of palm oil, used to make soap and for cooking, and the third biggest producer of natural rubber The rain forests of Sarawak ... is from the Hakata Dontaku Festival in Kyushu, which is steeped in over 820 years of history In the festival, Fukujin, Ebisu, and Daikoku, the three gods of good fortune, make the rounds of the...

Ngày tải lên: 13/11/2014, 07:14

151 252 0

QUY TRÌNH các bước để XIN GIẤY CHỨNG NHẬN XUẤT xứ (CERITIFICATE OF ORIGIN) FORM b đối với mặt HÀNG gạo (THƠM)

... tờ khai hải quan ngày khai tờ khai hải quan.(4) Nhập ngày nộp C/O.(5) Nhấn “xác nhận” (6) sau kiểm tra thông tin xác Sau nhấn xác nhận, nút k khai form (7) sáng lên tiếp tục ấn k khai form ... Chọn biểu tượng in để in tờ khai Chọn biểu tượng b t chì (2) để chỉnh sửa lại Chọn biểu tượng X (3) để b tờ khai - Sau chọn in tờ khai hệ thống cửa sổ tờ khai mẫu để kiểm tra lần cuối, sai sót ... C/O mua VCCI (form B) C/O sau hoàn tất chuẩn b chính, y để nộp xin xác nhận Sau form mẫu C/O doanh nghiệp 2.3 C/O giấy bao gồm chứng từ chọn phần B chứng từ” đơn xin cấp C/O khai: - Commercial...

Ngày tải lên: 11/03/2015, 16:11

20 1,3K 7

core competence of the corp C k prahalad g hamel

... lack the technical resources page of 15 The Core Competence of the Corporation to build competencies, but their top management often lacks the vision to build them and the administrative means for ... in the pursuit of new opportunities This may be compared to residents of an underdeveloped country hiding most of their cash under their mattresses The benefits of competencies, like the benefits ... Corporation: SBU or Core Competence.’’ Obviously, diversified corporations have a portfolio of products and a portfolio of businesses But we believe in a view of the company as a portfolio of competencies...

Ngày tải lên: 29/09/2015, 16:42

16 271 0