... has been the < /b> subject of < /b> a wide range of < /b> biophysical studies because of < /b> its abundance and ease of < /b> isolation from milk Its biological function is not clear, but it is a member of < /b> the < /b> lipocalin family ... 5°C The < /b> red line indicates the < /b> temperature of < /b> the < /b> sample The < /b> observed effects of < /b> adding KCl can be explained as follows In the < /b> absence of < /b> KCl, the < /b> coil-helix transition needs to be induced by ... KCl concentrations At 10mM and 15.3mM CaCl2 gelation was already observed in the < /b> absence of < /b> KCl (figure 3.5), but again addition of < /b> KCl led to faster gelation and stiffer gels The < /b> effect of < /b> KCl...
Ngày tải lên: 12/07/2015, 13:00
Structure and rheology of mixtures of the protein b lactoglobulin and the polysaccharide k carrageenan
... has been the < /b> subject of < /b> a wide range of < /b> biophysical studies because of < /b> its abundance and ease of < /b> isolation from milk Its biological function is not clear, but it is a member of < /b> the < /b> lipocalin family ... 5°C The < /b> red line indicates the < /b> temperature of < /b> the < /b> sample The < /b> observed effects of < /b> adding KCl can be explained as follows In the < /b> absence of < /b> KCl, the < /b> coil-helix transition needs to be induced by ... KCl concentrations At 10mM and 15.3mM CaCl2 gelation was already observed in the < /b> absence of < /b> KCl (figure 3.5), but again addition of < /b> KCl led to faster gelation and stiffer gels The < /b> effect of < /b> KCl...
Ngày tải lên: 18/07/2016, 20:12
... cells but not the < /b> rat hepatocytes This binding could be inhibited by recombinant HBs but not by the < /b> recombinant LHBs The < /b> binding of < /b> SHBs with human hepatocytes was further supported by the < /b> observation ... to the < /b> putative fusogenic domain of < /b> HBV suggests that the < /b> viral infection probably is the < /b> consequence of < /b> the < /b> exposure of < /b> HBV fusion domain (Figure B) [5,6] The < /b> proteolysis to make the < /b> viral fusion ... investigation was from the < /b> kinetic study of < /b> the < /b> uptake of < /b> DHBV by duck primary hepatocyte In 1999, Qiao and his colleagues have performed a kinetic study of < /b> DHBV uptake They observed that DHBV DNA appeared...
Ngày tải lên: 03/11/2012, 10:09
Tài liệu Báo cáo khoa học: Limited suppression of the interferon-b production by hepatitis C virus serine protease in cultured human hepatocytes pptx
... performed as described in Fig 1A (B) Effect of < /b> NS3-4A on IRF-3 dimerization induced by the < /b> ectopic expression of < /b> TRIF in PH5CH8 cells The < /b> dimerization analysis of < /b> IRF-3 was performed as described ... lysate of < /b> PH5CH8 cells transfected with the < /b> pCX4bsr vector was used as a control (NS–) (A) Effect of < /b> NS3-4A on the < /b> IFN -b gene promoter activated by T-pIC treatment (B) Effect of < /b> NS3-4A on the < /b> IFN -b ... as Cardif in PH5CH8 cells First, we confirmed the < /b> effect of < /b> NS3-4A on the < /b> activation of < /b> the < /b> IFN -b gene promoter by the < /b> Cardif exogenously expressed in PH5CH8 cells The < /b> results of < /b> the < /b> luciferase...
Ngày tải lên: 18/02/2014, 16:20
Tài liệu Báo cáo khoa học: Long-distance interactions between enhancers and promoters The case of the Abd-B domain of the Drosophila bithorax complex pdf
... differing in some fundamental way from that formed within the < /b> BX-C Conceivably, the < /b> normal function of < /b> the < /b> PTS in iab-7 is to help enhancers bypass the < /b> enhancer-blocking activity of < /b> the < /b> Fab)8 boundary ... reflects the < /b> difference between the < /b> complexities of < /b> the < /b> regulation of < /b> the < /b> two systems: a longer time is required for the < /b> formation of < /b> the < /b> complex looping structure in the < /b> case of < /b> BX-C, FEBS Journal ... in the < /b> case of < /b> Abd -B by the < /b> fact that the < /b> chromatin topology of < /b> the < /b> latter is likely to be different in different segments Hopefully, an increasing number of < /b> reporter genes inserted within different...
Ngày tải lên: 20/02/2014, 01:20
Báo cáo khoa học: Functional analysis of the aglycone-binding site of the maize b-glucosidase Zm-p60.1 pot
... F4 61L, F2 0 0K and P2 Furthermore, the < /b> F1 93A and W37 3K mutations not result in any change in the < /b> thermostability of < /b> the < /b> enzyme (Table S2), and thermal unfolding of < /b> the < /b> wild-type and both the < /b> F1 93A ... constructed four single (F1 93A, F2 0 0K, F4 61L and W37 3K) mutants and one quadruple (F1 93A F2 0 0K W37 3K F4 61L) mutant introducing features of < /b> the < /b> consensus motif into the < /b> Zm-p60.1 scaffold, then subjected ... masses of < /b> $ 110 and $ 43 kDa, respectively, (Fig 5A ,B and Table S3) The < /b> apparent molecular mass of < /b> $ 110 kDa is in good agreement with the < /b> 118 kDa calculated for the < /b> dimeric forms of < /b> the < /b> enzymes based...
Ngày tải lên: 16/03/2014, 04:20
Báo cáo khoa học: CpG methylation of the CENP-B box reduces human CENP-B binding pptx
... Tanaka et al revealed that the < /b> presence of < /b> the < /b> CENP -B box is essential for the < /b> formation of < /b> functional minichromosomes [15,16] Therefore, the < /b> CENP -B box is required for the < /b> formation of < /b> a functional ... and of < /b> the < /b> CENP -B box DNA reduces the < /b> CENP -B binding affinity almost to the < /b> level of < /b> nonspecific DNA binding A Discussion B Fig CpG methylation reduces the < /b> affinity between CENP -B and the < /b> CENP -B box ... methylation may be a reason for the < /b> reduced specificity of < /b> CENP -B to the < /b> CENP -B box sequence What is the < /b> functional meaning of < /b> the < /b> CpG methylation of < /b> the < /b> CENP -B box DNA? Recently, a link between centromeric...
Ngày tải lên: 16/03/2014, 18:20
The fabric of the cosmos b greene
... rigid flip book, it will sometin~es useful to think of < /b> it as a huge, fresh loaf of < /b> bread And in be place of < /b> the < /b> fixed pages that make u p a book -the < /b> fixed Newtonian time slices-think of < /b> the < /b> varlet> ... a peak of < /b> one wave and a peak of < /b> the < /b> other cross, the < /b> height of < /b> the < /b> water is even greater, being the < /b> sum of < /b> the < /b> hvo peak heights Sinilarly, when a trough of < /b> one wave and a trough of < /b> the < /b> other ... cases, the < /b> part of < /b> the < /b> probability wave left out of < /b> Figure 4.5 (the < /b> part extending throughout the < /b> rest of < /b> the < /b> universe) looks very much like the < /b> part near the < /b> edges of < /b> the < /b> figure: quite flat and...
Ngày tải lên: 17/03/2014, 14:04
Báo cáo khoa học: Direct CIII–HflB interaction is responsible for the inhibition of the HflB (FtsH)-mediated proteolysis of Escherichia coli r32 by kCIII docx
... respect, r32 resembles kCII Inhibition of < /b> H B- mediated proteolysis of < /b> r32 by CIII and by CIIIC The < /b> effect of < /b> CIII and CIIIC on the < /b> H B- mediated proteolysis of < /b> r32 was checked by treating r32-C-his ... does it apply only for CII? We examined the < /b> mode of < /b> the < /b> inhibitory action of < /b> CIII on proteolysis of < /b> the < /b> heat shock sigma factor r32, another substrate of < /b> H B Like proteolysis of < /b> CII, r32 proteolysis ... stopped by the < /b> addition of < /b> mm EDTA and SDS ⁄ PAGE loading buffer, followed by heating in a boiling water-bath for The < /b> amount of < /b> r32 that remained after proteolysis was analyzed after SDS ⁄ PAGE of < /b> the...
Ngày tải lên: 23/03/2014, 10:20
Báo cáo khoa học: Mechanism for transcriptional synergy between interferon regulatory factor (IRF)-3 and IRF-7 in activation of the interferon-b gene promoter docx
... C2-regions of < /b> CBP Thus, the < /b> bulk of < /b> the < /b> interaction between NF-jB and p300/CBP is mediated by the < /b> p65 subunit through the < /b> N- and C-terminal regions of < /b> the < /b> coactivators The < /b> pattern of < /b> IRF-1 binding ... greater if the < /b> virus-activated IRF-3/7 proteins could be used instead of < /b> the < /b> mutant forms, not only because of < /b> the < /b> difference in affinity for DNA, but also for the < /b> coactivators Nevertheless, the < /b> observation ... combinations of < /b> factors was investigated (Figs and 6) We first tested the < /b> effects of < /b> ATF-2/ c-Jun, IRF-1, IRF-3/IRF-7 and NF-jB (p50/p65), in the < /b> presence or absence of < /b> mammalian p300/CBP, on the...
Ngày tải lên: 23/03/2014, 13:20
Báo cáo khoa học: Interactions of the antimicrobial b-peptide b-17 with phospholipid vesicles differ from membrane interactions of magainins potx
... provides a measure of < /b> the < /b> average effect of < /b> the < /b> b- peptide on the < /b> curvature properties of < /b> the < /b> lipid measurements were performed in mL of < /b> buffer composed of < /b> 10 mM Hepes, 0.14 M NaCl, mM EDTA, pH 7.4, ... If b- 17 promoted the < /b> formation of < /b> a similar pore arrangement, but the < /b> diameter of < /b> the < /b> pore were smaller than that of < /b> magainin, then the < /b> negative curvature in the < /b> dimension around the < /b> rim of < /b> the < /b> ... in the < /b> form < /b> of < /b> LUVs delivered from a motor-driven syringe The < /b> reference cell contained the < /b> same buffer as the < /b> solution placed in the < /b> cell A buffer composed of < /b> 10 mM Hepes, 0.14 M NaCl, mM EDTA...
Ngày tải lên: 31/03/2014, 07:20
Báo cáo Y học: Barley a-amylase Met53 situated at the high-affinity subsite )2 belongs to a substrate binding motif in the bfia loop 2 of the catalytic (b/a)8-barrel and is critical for activity and substrate specificity pot
... QNDANDVVPNS-DANQNYWGYMTENYFSPDR FATINYSGVTN TAYHGYWARDFKKTNP GDRGF -APADYTRVDAAFGDW ASSDK -SFLDAIVQNGYAFTDRYDIGY VSSEDG SFLDSIIQNGYAFEDRYDLAM SSGDTNYGGMSFLDSFLNNGYAFTDRYDLGF KCPEG KSDGGYAVSSYRDVNP ... indicated by the < /b> effect on Cl-PNPG7 (Table 2) for which kinetic parameters were not determined due to the < /b> high Km and/or low kcat or for both reasons The < /b> rate of < /b> product release was 8% of < /b> that of < /b> wild-type ... presumably stemmed from a dominating loss of < /b> rate of < /b> catalysis as suggested by the < /b> kinetics properties of < /b> these mutants on amylose DP17 and Cl-PNPG7 (Table 3) Most remarkably binding of < /b> PNPG6 at subsites...
Ngày tải lên: 31/03/2014, 08:20
Báo cáo toán học: "A Presentation of the Elements of the Quotient Sheaves Ωk /Θk in Variational Sequences" pdf
... decomposition k r ∗ πr+1,r ρ = ρ0 + ρ1 + · · · + k We denote by pk : k → k the < /b> morphism of < /b> sheaves defined by pk ρ = ρq , r,q r r+1 r,q for ≤ q ≤ k k = ker pk , ≤ k ≤ n, is the < /b> sheave of < /b> contact k- forms ... r,0 r(c) k = ker pk r ,k n , n + ≤ k ≤ N , is the < /b> sheave of < /b> strongly contact k- forms r(c) Let k = d k 1 + k In [3] and [5] the < /b> authours proved the < /b> softness of < /b> r r(c) r(c) the < /b> sheaves k , considered ... = pk r,0 for all ≤ k ≤ n and for all k ∈ Ωr This is the < /b> horizontal component of < /b> k -form < /b> Let ≤ k ≤ n − and ∈ k , then r [ ] = fi1 ···ik dxi1 ∧ · · · ∧ dxik , (2) k! where fi1 ik are some functions...
Ngày tải lên: 06/08/2014, 05:20
Báo cáo toán học: "A refinement of the formula for k-ary trees and the Gould-Vandermonde’s convolution" pps
... colored leaf will be called the < /b> candidate leaf • The < /b> second class consists of < /b> the < /b> rest of < /b> trees, i.e., the < /b> trees in which there is no colored leaf in the < /b> lowest level (the < /b> level furthest to the < /b> root) ... classes of < /b> inverse relation [6, p.52] n bn = k= 0 m + ak n k z ak , an = n k n k= 0 −ak − m −an − m bk z n k , −an − m n k (9) we obtain Corollary 3.6 For n > 0, n (−1)n Cβ,γ (n) = k= 0 (1 − β )k − α ... paper of < /b> Bajunaid et al [1, 2005] They claimed that they did not find their result in the < /b> literature and they did not know any obvious combinatorial proof for their special case, even for (1) But,...
Ngày tải lên: 07/08/2014, 15:23
Báo cáo lâm nghiệp: "Influence of the form of nitrogen nutrition reductase activity in young black locus" doc
... Effect of < /b> nitrate of < /b> leaf NR activity of < /b> nodulafed plants Administration of < /b> mM NaN0 to 11 mo old nodulated plants did not increase leaf NR activity, whereas the < /b> 10 mM NaN0 dose ... activity (Fig 2) After 72 h of < /b> induction, the < /b> highest NR activity was found in the < /b> apical fully expanded leaf and corresponded with the < /b> highest nitrate content (Table I) When a new leaf expanded, the < /b> ... in the < /b> previous leaf and the < /b> highest enzyme activity was found again in the < /b> new leaf (Fig 2) When the < /b> nitrate supply was withdrawn, the < /b> enzyme activity recovered its minimum value after d (Fig...
Ngày tải lên: 09/08/2014, 04:20
Báo cáo y học: " Reconstitution of the adult B cell repertoire after treatment with rituximab" pptx
... nonquantitative nature of < /b> the < /b> bulk PCR approach employed by the < /b> investigators Furthermore, for most of < /b> the < /b> study total B cells were studied without differentiating specific B cell subsets This situation ... Research & Therapy October 2005 Vol No Sanz and Anolik points after treatment Some limitations of < /b> the < /b> work should be borne in mind, prominently the < /b> small number of < /b> patients studied and the < /b> nonquantitative ... provocative aspect of < /b> the < /b> study by Rouzière and coworkers [1] is the < /b> finding that even CD27– B cells exhibited a level of < /b> somatic hypermutation that was substantially higher than expected for either naïve...
Ngày tải lên: 09/08/2014, 07:20
Báo cáo y học: "Baicalein inhibits IL-1β- and TNF-α-induced inflammatory cytokine production from human mast cells via regulation of the NF-κB pathway" pot
... Figure 4analysis of < /b> effects of < /b> BAI on the < /b> gene expression of < /b> IL-6, IL-8, and MCP-1 in IL-1β- and TNF-α-activated HMC-1 cells RT-PCR RT-PCR analysis of < /b> effects of < /b> BAI on the < /b> gene expression of < /b> ... translocation of < /b> NF- B was analyzed by the < /b> EMSA using the < /b> nuclear fraction Seven micrograms of < /b> nuclear protein were added to ml of < /b> binding buffer (Promega, Madison, WI), and 35 fmol of < /b> double stranded NF- B ... Kwon YK, Shin SW, Kim SC, Choi YH, Park JW, Kwon TK: Differential inhibitory effects of < /b> baicalein and baicalin on LPS-induced cyclooxygenase-2 expression through inhibition of < /b> C/EBPbeta DNA-binding...
Ngày tải lên: 13/08/2014, 13:22
geography of the world b
... distributed More than 80 percent of < /b> the < /b> people live in the < /b> provinces of < /b> Punjab and Sind, on the < /b> fertile floodplains of < /b> the < /b> rivers The < /b> flat, fertile plains of < /b> the < /b> Punjab form < /b> the < /b> farming heartland of < /b> ... reserves off the < /b> coast of < /b> Sarawak The < /b> country is the < /b> world’s top producer of < /b> palm oil, used to make soap and for cooking, and the < /b> third biggest producer of < /b> natural rubber The < /b> rain forests of < /b> Sarawak ... is from the < /b> Hakata Dontaku Festival in Kyushu, which is steeped in over 820 years of < /b> history In the < /b> festival, Fukujin, Ebisu, and Daikoku, the < /b> three gods of < /b> good fortune, make the < /b> rounds of < /b> the...
Ngày tải lên: 13/11/2014, 07:14
QUY TRÌNH các bước để XIN GIẤY CHỨNG NHẬN XUẤT xứ (CERITIFICATE OF ORIGIN) FORM b đối với mặt HÀNG gạo (THƠM)
... tờ khai hải quan ngày khai tờ khai hải quan.(4) Nhập ngày nộp C/O.(5) Nhấn “xác nhận” (6) sau kiểm tra thông tin xác Sau nhấn xác nhận, nút k khai form< /b> (7) sáng lên tiếp tục ấn k khai form< /b> ... Chọn biểu tượng in để in tờ khai Chọn biểu tượng b t chì (2) để chỉnh sửa lại Chọn biểu tượng X (3) để b tờ khai - Sau chọn in tờ khai hệ thống cửa sổ tờ khai mẫu để kiểm tra lần cuối, sai sót ... C/O mua VCCI (form < /b> B) C/O sau hoàn tất chuẩn b chính, y để nộp xin xác nhận Sau form < /b> mẫu C/O doanh nghiệp 2.3 C/O giấy bao gồm chứng từ chọn phần B chứng từ” đơn xin cấp C/O khai: - Commercial...
Ngày tải lên: 11/03/2015, 16:11
core competence of the corp C k prahalad g hamel
... lack the < /b> technical resources page of < /b> 15 The < /b> Core Competence of < /b> the < /b> Corporation to build competencies, but their top management often lacks the < /b> vision to build them and the < /b> administrative means for ... in the < /b> pursuit of < /b> new opportunities This may be compared to residents of < /b> an underdeveloped country hiding most of < /b> their cash under their mattresses The < /b> benefits of < /b> competencies, like the < /b> benefits ... Corporation: SBU or Core Competence.’’ Obviously, diversified corporations have a portfolio of < /b> products and a portfolio of < /b> businesses But we believe in a view of < /b> the < /b> company as a portfolio of < /b> competencies...
Ngày tải lên: 29/09/2015, 16:42