cho lược đồ quan hệ q abcd r là một quan hệ trên q

Giao trinh co so du lieu potx

Giao trinh co so du lieu potx

Ngày tải lên : 11/08/2014, 16:21
... quan h l khụng quan trng nờn ta cú: r1 , r2 thỡ r1 + r2 = r2 + r1 r thỡ r + r = r Mt cỏch tng quỏt cú th ly hp ca n quan h tng thớch: cho n quan h tng thớch r1 ,r2 ,,rn Hp ca n quan h r1 ,r2 ,,rn ... , r2 l hai quan h trờn Q 1 ,Q2 tng ng Tớch Descartes (decac) ca r1 v r2 ký hiu l r1 x r2 l quan h trờn lc quan h cú thuc tớnh Q= Q1 Q2 Vy quan h r1 x r2 l quan h trờn lc : Q = Q1 Q2 = { A1,A2, ... Cho hai quan h tng thớch r v r2 Hp ca hai quan h r v r2 ký hiu l r1 + r2 l mt quan h trờn lc quan h Q gm cỏc phn t thuc r hoc thuc r2 , tc l: r1 + r2 = {t / t r1 hoc t r2 } Vớ d 2.2 r1 r2 A a1...
  • 113
  • 238
  • 0
Thực trạng và giải pháp phát triển hệ thống cửa hàng tiện lợi Citimart B and B

Thực trạng và giải pháp phát triển hệ thống cửa hàng tiện lợi Citimart B and B

Ngày tải lên : 01/04/2013, 11:40
... Khai, quận Hình 2.1: Sơ đồ bố trí quầy hàng cửa hàng Citimart Sommerset b Đối vớichi nhánh Citimart B&B, NguyễnLương Bằng, quận Tầngtrệt Hình 2.2: Sơ đồ bố trí quầy hàng cửa hàng Citimart B&B Green ... nhiều thời gian cho mua sắm 2.2 Bố trí quầy hàng Với đặc điểm phân khúc thị trường trình bày trên, Citimart xây dựng hệ thống bốtríquầyhàng nhằm đem lại tiện lợi nhanh chóng cho khách hàng Phần ... Tầng Hình 2.3: Sơ đồ bố trí quầy hàng cửa hàng Citimart B&BGreen View c Đối với chi nhánh Citimart B&B Nam Long, HàHuyTập, quận Tầng Hình 2.4: Sơ đồ bố trí quầy hàng cửa hàng Citimart B&B Nam Long...
  • 29
  • 1.2K
  • 6
B and V Minimal Pair Quiz .doc

B and V Minimal Pair Quiz .doc

Ngày tải lên : 25/08/2013, 08:10
... important of her internal organs is a woman's _ a liver b libber 18 _ Shepherd was famous for her role in the TV series "Moonlighting" a Civil b Cybill 19 Park your car next to the _ a curve ... http://binhqx.violet.vn b boll 13 _ writers include Jane Austen, E.M Forster and Terry McMillan a Rebel b Revel 14 After a bath it is nice to lounge around in a terry-cloth _ a rove b robe 15 ... Batman's _ was the Joker a rival b libel 17 The road will _ to the right and then go straight through the park a curve b curb 18 A _ is more than a friend a lover b lubber 19 The symbol of peace...
  • 12
  • 444
  • 0
Tài liệu Báo cáo khoa học: Proteolysis of Pseudomonas exotoxin A within hepatic endosomes by cathepsins B and D produces fragments displaying in vitro ADP-ribosylating and apoptotic effects doc

Tài liệu Báo cáo khoa học: Proteolysis of Pseudomonas exotoxin A within hepatic endosomes by cathepsins B and D produces fragments displaying in vitro ADP-ribosylating and apoptotic effects doc

Ngày tải lên : 18/02/2014, 04:20
... VAAGECAGPADSGDALLERNYPTGAEFLGDGGDVSFSTRGTQNWTVERLLQAHRQLEERGYV FVGYHGTFLEAAQSIVFGGVRARSQDLDAIWRGFYIAGDPALAYGYAQDQEPDARGRIRNGA LLRVYVPRSSLPGFYRTSLTLAAPEAAGEVERLIGHPLPLRLDAITGPEEEGGRLETILGWP LAERTVVIPSAIPTDPRNVGGDLDPSSIPDKEQAISALPDYASQPGKPPREDLK613 ... WSEWASGKVLCLLDPLDGVYNYLAQQRCNLDDTWEGKIYRVLAGNPAKHDLDIKPTVISHRL HFPEGGSLAALTAHQACHLPLETFTRHRQPR279 280 ETA-A GWEQLEQCGYPVQRLVALYLAARLSWNQVDQV IRNALASPGSGGDLGEAIREQPEQARLALTLAAAESERFVRQGTGNDEAGAANADVVSLTCP ... reductive processing of ETA should be required for ETA cytotoxicity through the retrograde transport pathway [18], it has not been clearly determined whether ETA requires proteolytic and ⁄ or reductive...
  • 15
  • 588
  • 0
Tài liệu Báo cáo khoa học: High affinity copper binding by stefin B (cystatin B) and its role in the inhibition of amyloid fibrillation docx

Tài liệu Báo cáo khoa học: High affinity copper binding by stefin B (cystatin B) and its role in the inhibition of amyloid fibrillation docx

Ngày tải lên : 19/02/2014, 06:20
... kcal/mole of injectant Near UV CD spectra are a better measure of protein tertiary structure and thus the solution conformation There are cases where the tertiary structure can denature with no substantial ... G, Gutierrez-Aguirre I, Rabzelj S, Ceru S, ˇ ˇ Kopitar-Jerala N, Macek P, Turk V & Zerovnik E (2005) Interaction of human stefin B in the prefibrillar oligomeric form with membranes Correlation ... recombinant proteins We also are grateful to Sabina Rabzelj and Sasˇ a Jenko Kokalj for performing certain SEC experiments and for activity measurements We are grateful to Professor Roger H Pain for suggesting...
  • 14
  • 586
  • 0
Hepatitis and Liver Cancer: A National Strategy for Prevention and Control of Hepatitis B and C ppt

Hepatitis and Liver Cancer: A National Strategy for Prevention and Control of Hepatitis B and C ppt

Ngày tải lên : 06/03/2014, 01:20
... York Staff Abigail E Mitchell, Study Director Heather M Colvin, Program Officer Kathleen M McGraw, Senior Program Assistant Norman Grossblatt, Senior Editor Rose Marie Martinez, Director, Board ... universally cover all ACIP-recommended vaccinations for children and adults Furthermore, most privately insured persons are required to pay to receive vaccinations To reduce barriers to children ... http://www.nap.edu/catalog/12793.html REVIEWERS This report has been reviewed in draft form by persons chosen for their diverse perspectives and technical expertise, in accordance with procedures approved by the National Research...
  • 191
  • 457
  • 0
Hepatitis and Liver Cancer: A National Strategy for Prevention and Control of Hepatitis B and C doc

Hepatitis and Liver Cancer: A National Strategy for Prevention and Control of Hepatitis B and C doc

Ngày tải lên : 06/03/2014, 01:20
... of service preferred provider organization person year QALY quality adjusted life year RCT RIBA RNA RSV randomized clinical trial recombinant immunoblot assay ribonucleic acid respiratory syncytial ... http://www.nap.edu/catalog/12793.html Reviewers T his report has been reviewed in draft form by persons chosen for their diverse perspectives and technical expertise, in accordance with procedures approved by the National Research ... York Study Staff Abigail E Mitchell, Study Director Heather M Colvin, Program Officer Kathleen M McGraw, Senior Program Assistant Norman Grossblatt, Senior Editor Rose Marie Martinez, Director,...
  • 253
  • 369
  • 0
Báo cáo khoa học: Ternary complex formation of pVHL, elongin B and elongin C visualized in living cells by a fluorescence resonance energy transfer–fluorescence lifetime imaging microscopy technique docx

Báo cáo khoa học: Ternary complex formation of pVHL, elongin B and elongin C visualized in living cells by a fluorescence resonance energy transfer–fluorescence lifetime imaging microscopy technique docx

Ngày tải lên : 16/03/2014, 05:20
... occurrence of FRET and minimize risk due to interference from sample autofluorescence It is also reported that reduced lifetimes of donors can occur by the strong illumination from a mercury lamp ... occurring in living cells The occurrence of FRET can be accurately and finely determined by measuring the reduced fluorescence lifetime of donor proteins in the presence of acceptors Because fluorescence ... Flag-elongin C were expressed in CHO- K1 cells Whole cell extracts were treated with anti-Flag serum Co-precipitated proteins were visualized with anti-HA, anti-Flag or anti-myc sera after electrophoresis...
  • 9
  • 420
  • 0
Hepatitis and Liver Cancer: A National Strategy for Prevention and Control of Hepatitis B and C pdf

Hepatitis and Liver Cancer: A National Strategy for Prevention and Control of Hepatitis B and C pdf

Ngày tải lên : 22/03/2014, 17:20
... Director, Cooper Green Hospital, Birmingham, Alabama Study Staff Abigail E Mitchell Study Director Norman Grossblatt Senior Editor Heather M Colvin Program Officer Rose Marie Martinez Director, ... Federal Employees Health Benefits Program, incorporate guidelines for risk-factor screening for hepatitis B and hepatitis C as a required core component of preventive care This will allow at-risk ... currently not provide accurate estimates of the current burden of disease and are insufficient for program planning and evaluation The committee recommends that the Centers for Disease Control...
  • 4
  • 404
  • 1
Báo cáo khoa học: Nuclear factor kappa B and tumor necrosis factor-alpha modulation of transcription of the mouse testis- and pre-implantation development-specific Rnf33⁄Trim60 gene pot

Báo cáo khoa học: Nuclear factor kappa B and tumor necrosis factor-alpha modulation of transcription of the mouse testis- and pre-implantation development-specific Rnf33⁄Trim60 gene pot

Ngày tải lên : 29/03/2014, 00:20
... SYBR Green PCR Master Mix (Finnzymes) and 0.4 lm each of forward and reverse primers PCR primers for Rnf33 were F1466 and Rnf33-qPCR -R (5¢-GTTCTTAGAGGTCCA TAGGTGACA-3¢) For normalization, the mRNA ... the pGL3 promoter Construct US -R4 F that carried full-length R4 (see Fig 3B) was included for comparison RLU, relative luciferase activities B C F 1R4 -3 or F 1R4 -2, partially restored transcriptional ... the crucial cis regulatory sequence To further dissect the transcriptional contribution, the 305-bp R4 was arbitrarily divided into three regions, approximately equal in size, for luciferase...
  • 14
  • 381
  • 0
hepatitis b and d protocols volume 1

hepatitis b and d protocols volume 1

Ngày tải lên : 11/04/2014, 09:45
... primer and primer PCR mix 3–4: same as PCR mix 1–2, but use primer and primer instead of primer and primer PCR mix 5–6: same as PCR mix 1–2, but use primer and primer instead of primer and primer ... truncated (tr) RNA Other primer pairs are used to recognize corresponding regions on DNA Table shows a list of suitable primers for PCR and RT–PCR and primers for establishing probes, together with ... 3' region as a region common to all HBV transcripts PCR and RT–PCR are performed using both conventional primer pairs and primer pairs that are targeted to the transition site of transcript sequences...
  • 333
  • 403
  • 0
hepatitis b and d protocols volume 2

hepatitis b and d protocols volume 2

Ngày tải lên : 11/04/2014, 09:45
... described in the instruction manual of the RiboQuant™ for preparation of 32P-labeled RNA probes, hybridization with total RNAs purified from liver, and RNase treatments using the kit Prepare 150 ... is important to target the middle rather than the lower part of the abdomen to avoid damage or rupture of the urinary bladder References Chisari, F V and Ferrari, C (1995) Hepatitis B virus immunopathogenesis ... 200°C for h; cool the devices with liquid nitrogen before use A microcentrifuge (Eppendorf 5415 C, Eppendorf, Hamburg, Germany) GeneQuant pro RNA/DNA calculator and Microvolume spectrometer cells...
  • 549
  • 454
  • 0
Báo cáo hóa học: "Quantification of newly produced B and T lymphocytes in untreated chronic lymphocytic leukemia patients" ppt

Báo cáo hóa học: "Quantification of newly produced B and T lymphocytes in untreated chronic lymphocytic leukemia patients" ppt

Ngày tải lên : 18/06/2014, 16:20
... DNA extracted from a lymphoblastoid B-cell line, in order to obtain decreasing concentration of tumoral DNA Straight line: regression line for KRECs; dotted-line: regression line for TRECs Quantification ... cytometric analysis and for peripheral blood mononuclear cells (PBMC) preparation by Ficoll-Hypaque gradient centrifugation The participants, who were prospectively enrolled from November 2007 ... or TRECs quantity mean of TRAC quantity / (1) The mean quantity of TRAC has to be divided by because each cell carries two copies of TRAC gene, i.e., one for each chromosome Motta et al Journal...
  • 7
  • 559
  • 0
Báo cáo sinh học: " High Chromosome Number in hematological cancer cell lines is a Negative Predictor of Response to the inhibition of Aurora B and C by GSK1070916" potx

Báo cáo sinh học: " High Chromosome Number in hematological cancer cell lines is a Negative Predictor of Response to the inhibition of Aurora B and C by GSK1070916" potx

Ngày tải lên : 18/06/2014, 22:20
... responders required greater than or equal to a 96 hour exposure with GSK1070916 for the majority of cells to contain sub2N DNA Furthermore, the Ymin (minimum response of the dose response curve) ... with Aurora B inhibitors Conveniently, it is standard clinical practice to perform karyotyping on hematological cancer cells and chromosome number can serve as a resistance marker for patient response ... expected frequency of high chromosome number in the patient population, we reviewed the Mitelman Database of Chromosome Aberrations in Cancer [20] Transcriptomics mRNA transcript expression was quantified...
  • 10
  • 618
  • 0
báo cáo hóa học: " Aspirin-triggered lipoxin A4 attenuates LPSinduced pro-inflammatory responses by inhibiting activation of NF-B and MAPKs in BV-2 microglial cells" pptx

báo cáo hóa học: " Aspirin-triggered lipoxin A4 attenuates LPSinduced pro-inflammatory responses by inhibiting activation of NF-B and MAPKs in BV-2 microglial cells" pptx

Ngày tải lên : 19/06/2014, 22:20
... ALX1/FPR-rs1 and ALX2/FPR2 mRNAs were examined by RT-PCR b-Actin was used as a loading control RT-PCR products were electrophoresed on 2% agarose gel Quantification of ALX1/FPR-rs1 and ALX2/FPR2 mRNAs ... bp product for bactin The amplified PCR products were resolved by 2% agarose gel electrophoresis Real-time PCR was performed for a quantitative analysis of iNOS, IL-1b and TNF-a mRNA expression ... using Quantity One Version 4.6.3 Image software (Bio-Rad) and normalized against proper loading controls Electrophoretic mobility shift assay (EMSA) Nuclear extracts were prepared as described...
  • 12
  • 414
  • 0
o cáo hóa học:" High Chromosome Number in hematological cancer cell lines is a Negative Predictor of Response to the inhibition of Aurora B and C by GSK1070916" ppt

o cáo hóa học:" High Chromosome Number in hematological cancer cell lines is a Negative Predictor of Response to the inhibition of Aurora B and C by GSK1070916" ppt

Ngày tải lên : 20/06/2014, 04:20
... responders required greater than or equal to a 96 hour exposure with GSK1070916 for the majority of cells to contain sub2N DNA Furthermore, the Ymin (minimum response of the dose response curve) ... with Aurora B inhibitors Conveniently, it is standard clinical practice to perform karyotyping on hematological cancer cells and chromosome number can serve as a resistance marker for patient response ... expected frequency of high chromosome number in the patient population, we reviewed the Mitelman Database of Chromosome Aberrations in Cancer [20] Transcriptomics mRNA transcript expression was quantified...
  • 10
  • 665
  • 0
Báo cáo hóa học: " Effect of Interfacial Bonds on the Morphology of InAs QDs Grown on GaAs (311) B and (100) Substrates" potx

Báo cáo hóa học: " Effect of Interfacial Bonds on the Morphology of InAs QDs Grown on GaAs (311) B and (100) Substrates" potx

Ngày tải lên : 22/06/2014, 00:20
... and further to modify the equilibrium 123 structures These structural characteristics would surely induce different properties So this effect offers one parameter for the design and fabrication ... however, for the InAs/GaAs samples, tc311 is larger than tc100 For the self-assembled QDs, tc is an important parameter For it determines when the islands were formed during the growth, which therefore ... substrates were mature, those grown on GaAs (100) substrates were clearly underdeveloped Most of the QDs grown on GaAs (100) substrates were very small sized and only a few QDs can be clearly...
  • 5
  • 326
  • 0
Báo cáo toán học: " Geometrically constructed bases for homology of partition lattices of types A, B and D" ppt

Báo cáo toán học: " Geometrically constructed bases for homology of partition lattices of types A, B and D" ppt

Ngày tải lên : 07/08/2014, 08:22
... of the paper The proper setting for our discussion is that of real hyperplane arrangements, or (even more generally) oriented matroids Let A be an arrangement of linear hyperplanes in Rd We assume ... → LA is clearly order-reversing, and it restricts to an order-reversing map z : P A → LA {ˆ 0} In various versions, the following result appears in several places in the literature; see the discussion ... (T )) Proof The proof, which is similar to that of Theorem 9.1, uses results from Section and is left to the reader Remark 9.4 There are easier and more direct ways to prove Theorem 9.3 For instance,...
  • 26
  • 288
  • 0
Báo cáo y học: "IL-17 induces production of IL-6 and IL-8 in rheumatoid arthritis κ synovial fibroblasts via NF-κB- and PI3-kinase/Akt-dependent pathways" doc

Báo cáo y học: "IL-17 induces production of IL-6 and IL-8 in rheumatoid arthritis κ synovial fibroblasts via NF-κB- and PI3-kinase/Akt-dependent pathways" doc

Ngày tải lên : 09/08/2014, 01:23
... http://arthritis-research.com/content/6/2 /R1 20 Figure Figure (a) (a) IL-15 (pg/ml) IL-17 RB Ratio 2000 IL-17 R 1500 1000 500 RA4 RA7 RA8 RA4 RA7 RA8 RA7 RA8 RA9 RA3 RA7 RA8 RA9 RA2 RA3 RA7 RA8 RA9 ... insulin–transferrin–selenium-A (Invitrogen, Carlsbad, CA, USA) for 24 hours before the addition of cytokines and other reagents RT-PCR analysis of IL-17 receptors FLS lines were cultured for hours ... IL-17 R (c) 2000 IL-17 RB IL-8 (pg/ml) Ratio RA3 (b) 20 10 0 RA2 RA2 RA4 RA7 RA8 RA4 RA7 RA8 (h ou rs )2 0 Expression and induction of IL-1 7R and IL-17RB in IL-17-stimulated FLS from six RA patients...
  • 9
  • 411
  • 0
Báo cáo y học: " Tumour necrosis factor-α stimulates dehydroepiandrosterone metabolism in human fibroblast-like synoviocytes: a role for nuclear factor-κB and activator protein-1 in the regulation of expression of cytochrome p450 enzyme 7b" doc

Báo cáo y học: " Tumour necrosis factor-α stimulates dehydroepiandrosterone metabolism in human fibroblast-like synoviocytes: a role for nuclear factor-κB and activator protein-1 in the regulation of expression of cytochrome p450 enzyme 7b" doc

Ngày tải lên : 09/08/2014, 07:20
... Dehydroepiandrosterone is a natural enhancer of interleukin synthesis by helper T cells Eur J Immunol 1990, 20:793-802 Morfin R, Courchay G: Pregnenolone and dehydroepiandrosterone as precursors ... nucleotides were selected in relation to the transcription start site Promoter analysis for transcription factor binding sites was performed using the GEMSLauncher version 3.6 from Genomatrix and MatInspector ... bars) tumour necrosis factor (TNF)-α for another 24 hours with 1.5 × 10-8 mol/l 3H-DHEA, as described in Materials and methods Data are expressed as mean ± standard error of the mean and are representative...
  • 10
  • 462
  • 0