chinese unknown word identification
Tài liệu Báo cáo khoa học: Identification of Ewing’s sarcoma protein as a G-quadruplex DNA- and RNA-binding protein ppt
Ngày tải lên :
15/02/2014, 01:20
... APKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGP
GGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPP
GPLMEQMGGRRGGRGGPGKMDKGEHRQERRDRPY
K. Takahama et al. Identification of Ewing’s sarcoma protein
FEBS Journal 278 (2011) 988–998 ª 2011 The Authors Journal compilation ª 2011 FEBS 991
Identification of Ewing’s sarcoma ... labeled
DNA. The DNA–protein complexes were resolved by 6% PAGE
and visualized by autoradiography.
Identification of Ewing’s sarcoma protein K. Takahama et al.
992 FEBS Journal 278 (2011) 988–998 ... DNA–protein complexes were resolved by 6% PAGE and visu-
alized by autoradiography.
K. Takahama et al. Identification of Ewing’s sarcoma protein
FEBS Journal 278 (2011) 988–998 ª 2011 The Authors Journal...
- 11
- 786
- 0
Tài liệu Báo cáo khoa học: Identification and characterization of the transcription factors involved in T-cell development, t-bet, stat6 and foxp3, within the zebrafish, Danio rerio docx
Ngày tải lên :
16/02/2014, 09:20
... discovery, the Ginbuna crucian carp
sequence was unknown. This approach enabled t-bet
and foxp3 to be obtained quickly, as a major difficulty
in the identification of transcription factors is that
Table ... 169–182.
84 Zou J, Carrington A, Collet B, Dijkstra JM, Yoshiura
Y, Bols N & Secombes C (2005) Identification and
bioactivities of IFN-gamma in rainbow trout Oncorhyn-
chus mykiss: the first Th1-type ... genome. The zebrafish gen-
ome was searched using the human stat6 amino acid
sequence directly for identification.
The zebrafish t-bet homologue is predicted to contain
609 amino acids, the stat6 homologue...
- 20
- 689
- 0
Tài liệu Báo cáo khoa học: The cellulosomes from Clostridium cellulolyticum Identification of new components and synergies between complexes ppt
Ngày tải lên :
18/02/2014, 08:20
... xylanase F1 fraction combined with either the
Table 1. Identification of specific components detected in fractions F1, F5 and F6 using MS analysis. All identifications were based on pep-
tide mass fingerprint ... acquisition.
Maximum coverage identification was carried out using the
big three program included in the data acquisition Xcali-
bur
Ô
Finnigan proteomex 2.0 software program. Protein
identification was performed ... (http://www.cazy.org); Doc, dockerin domain; Ig, immunoglobulin-like domain of cellulase; X2, Ig-like module of unknown func-
tion; M
r
, theoretical molecular mass of the mature protein. The cleavage site was...
- 11
- 599
- 0
Tài liệu Báo cáo khoa học: Identification of two late acyltransferase genes responsible for lipid A biosynthesis in Moraxella catarrhalis doc
Ngày tải lên :
18/02/2014, 14:20
... antisense) [19]
Identification of M. catarrhalis lpxX and lpxL S. Gao et al.
5206 FEBS Journal 275 (2008) 5201–5214 Journal compilation ª 2008 FEBS. No claim to original US government works
Identification ... Bacteriol 179, 5521–5533.
33 McLendon MK, Schilling B, Hunt JR, Apicella MA &
Gibson BW (2007) Identification of LpxL, a late acyl-
transferase of Francisella tularensis. Infect Immun 75,
5518–5531.
34 ... lipooligosaccharide from
Moraxella catarrhalis conjugated to proteins. Infect
Immun 68, 4980–4985.
Identification of M. catarrhalis lpxX and lpxL S. Gao et al.
5214 FEBS Journal 275 (2008) 5201–5214...
- 14
- 674
- 0
Tài liệu Báo cáo khoa học: Identification and characterization of an R-Smad ortholog (SmSmad1B) from Schistosoma mansoni pdf
Ngày tải lên :
18/02/2014, 16:20
... this
study, we report the identification of SmSmad1B
cDNA and present its gene structure along with the
expression profiles, immunolocalization, and protein
interaction properties.
Results
Identification of ... implication that host molecules may be exploited
by schistosomes to enhance the parasites’ development
Keywords
bone morphogenic protein; Schistosoma
mansoni; Smad; transforming growth
factor-b
Correspondence
P. ... levels by approximately 45% in the
later stages (35 days or older) of mammalian develop-
ment [6].
Identification and immunolocalization of
SmSmad1B protein in adult schistosomes
To detect the native...
- 19
- 653
- 0
Tài liệu Báo cáo khoa học: Identification, sequencing, and localization of a new carbonic anhydrase transcript from the hydrothermal vent tubeworm Riftia pachyptila docx
Ngày tải lên :
18/02/2014, 16:20
... of
carbonic anhydrase. Mar Biol 100, 195–202.
14 Kochevar RE, Govind NS & Childress JJ (1993)
Identification and characterization of two carbonic
anhydrases from the hydrothermal vent tubeworm
Riftia ... et al.
5316 FEBS Journal 274 (2007) 5311–5324 ª 2007 The Authors Journal compilation ª 2007 FEBS
Identification, sequencing, and localization of a new
carbonic anhydrase transcript from the hydrothermal
vent ... organ, where it is immediately converted
into bicarbonate through high activities of carbonic
Keywords
chemoautotrophy; differential expression;
messenger RNA; symbiosis; Siboglinidae
Correspondence
F....
- 14
- 591
- 0
Tài liệu Báo cáo khoa học: Identification of differentially expressed genes of the Pacific oyster Crassostrea gigas exposed to prolonged thermal stress docx
Ngày tải lên :
18/02/2014, 16:20
... (2007) 6392–6402 Journal compilation ª 2007 FEBS. No claim to original French government works
Identification of differentially expressed genes of the
Pacific oyster Crassostrea gigas exposed to ... ranging from 4 to 24 °C [8]. In the coldest
regions inhabited by C. gigas, such as Brittany,
Keywords
climate; Crassostrea gigas; gene expression;
heat stress; prolonged thermal stress
Correspondence
M....
- 11
- 570
- 0
Tài liệu Báo cáo khoa học: Suppressed catalytic efficiency of plasmin in the presence of long-chain fatty acids Identification of kinetic parameters from continuous enzymatic assay with Monte Carlo simulation ppt
Ngày tải lên :
18/02/2014, 17:20
... overall catalytic outcome may vary with
the concentration of the substrate.
The approach used for the identification of kinetic
parameters in this study exploited the advantages of
progress curve evaluation ... distribution of the
parameters estimated using this robust evaluation
procedure was essential for the identification of the
statistical significance of the described effects. In con-
clusion, our study ... such conditions
the mathematical procedure operating with K
i
and J
3
is an indispensable tool in identification of the k
p
and
K
m
values because it is able to eliminate the super-
imposed assay-dependent...
- 9
- 473
- 0
Tài liệu Báo cáo khoa học: Identification of a novel matrix protein contained in a protein aggregate associated with collagen in fish otoliths pdf
Ngày tải lên :
18/02/2014, 17:20
... 483–489.
16 Perkins DN, Pappin DJC, Creasy DM & d Cottrell JS
(1999) Probability-based protein identification by
searching sequence databases using mass spectrometry
data. Electrophoresis 20, ... of the sacculus, by contrast, mRNA hybrid-
ization signals were barely detectable (Fig. 2C,D).
Identification of the calcium-binding domain in
OMM-64
To determine the regions that have calcium-binding
activity, ... framework
FEBS Journal 275 (2008) 2512–2523 ª 2008 The Authors Journal compilation ª 2008 FEBS 2515
Identification of a novel matrix protein contained in a
protein aggregate associated with collagen...
- 12
- 568
- 0
Tài liệu Báo cáo khoa học: Direct identification of hydrophobins and their processing in Trichoderma using intact-cell MALDI-TOF MS docx
Ngày tải lên :
19/02/2014, 02:20
... well-known
hydrophobins were suspected to be the signal source,
and some were assigned by database analysis.
Identification of the class II hydrophobins
produced by H. jecorina
In order to identify the already ... highly abundant intracellular
constituents [22]. This set of about 10–30 defined
masses permits the identification at the species and
subspecies ⁄ strain level. We here show that in filamen-
tous fungi, ... ubiquitins. The sensitivity of detection
employing the MALDI-TOF technique can be expec-
ted to allow the identification of bacterial peptides
with 100 microbial cells.
Experimental procedures
Reagents...
- 12
- 632
- 0
Tài liệu Báo cáo khoa học: Identification of b-amyrin and sophoradiol 24-hydroxylase by expressed sequence tag mining and functional expression assay docx
Ngày tải lên :
19/02/2014, 07:20
... cerevisiae yielded olean-12-ene-3b,24-diol. This
is the first identification of triterpene hydroxylase cDNA from any plant
species. Successful identification of a b-amyrin and sophoradiol 24-hydroxy-
lase ... enzymes, it was unex-
pected that CYP93E1 would encode b-amyrin and
sophoradiol 24-hydroxylase. The identification of
CYP93E1 as triterpene hydroxylase implies that the
function of other members of ... CYP93E1
FEBS Journal 273 (2006) 948–959 ª 2006 The Authors Journal compilation ª 2006 FEBS 949
Identification of b-amyrin and sophoradiol 24-hydroxylase
by expressed sequence tag mining and functional
expression...
- 12
- 704
- 0
Tài liệu Báo cáo khoa học: Identification of GAS-dependent interferon-sensitive target genes whose transcription is STAT2-dependent but ISGF3-independent doc
Ngày tải lên :
19/02/2014, 07:20
... activation
22.5
Hypothetical ⁄ unknown (10)
FLJ21198 fis, clone COL00220 Function unknown 58.0
ESTs, Moderately similar to G02654
ribosomal protein L39
Function unknown 44.7
mRNA for KIAA0550 ... protein
35.0
PAR5 gene Similar to small nuclear ribonucleoprotein polypeptide N,
function unknown
30.5
Unknown clone 12262, mRNA Similar to translocase of inner mitochondrial membrane 8
homolog ... and FccRI, have
been identified to date [10].
Microarray gene expression analyses have led to the
identification of numerous ISGs and have implicated
IFNs in activities as diverse as cell adhesion,...
- 13
- 459
- 0
Tài liệu Báo cáo khoa học: Identification of membrane-bound serine proteinase matriptase as processing enzyme of insulin-like growth factor binding protein-related protein-1 (IGFBP-rP1/angiomodulin/mac25) doc
Ngày tải lên :
19/02/2014, 07:20
... Maile LA & Holly JM (1999) Insulin-like growth binding
protein (IGFBP) proteolysis: occurrence, identification,
role and regulation. Growth Horm IGF Res 9, 85–95.
25 Collett-Solberg PF & Cohen ... Coughlin
SR & Craik CS (2000) Cellular localization of
membrane-type serine protease 1 and identification of
protease-activated receptor-2 and single-chain
urokinase-type plasminogen activator ... Glycobiology 14,
139–146.
35 Shi YE, Torri J, Yieh L, Wellstein A, Lippman ME &
Dickson RB (1993) Identification and characterization
of a novel matrix-degrading protease from hormone-
dependent...
- 13
- 603
- 0
Tài liệu Báo cáo khoa học: Bioinformatics of the glycoside hydrolase family 57 and identification of catalytic residues in amylopullulanase from Thermococcus hydrothermalis doc
Ngày tải lên :
19/02/2014, 12:20
... the proposed conserved sequen ce regions (Fig. 1), our
alignment constitutes a valid base for the identification o f
other f unctional r esidues i n both the present and future
GH-57 members.
Acknowledgements
The ... bonds. The align-
ment and mutagenesis strategy employed by v an Lieshout
et al . [36] allowed the identification of Glu117 as the catalytic
nucleophile (analogous to residue Glu123 in O32462_
THELI ... 248, 171–178.
35. Imamura, H., Fushinobu, S., Jeon, B.S., Wakagi, T. &
Matsuzawa, H. (2001) Identification of t he catalytic residue of
Thermococcus litoralis 4-a-glucanotransferase through...
- 10
- 577
- 0
Tài liệu Báo cáo khoa học: What makes biochemical networks tick? A graphical tool for the identification of oscillophores ppt
Ngày tải lên :
19/02/2014, 16:20
... method,
illustrating two new main classes of oscillophore topologies.
Keywords: graph-theoretic approach; kinetic mode lling;
oscillations; s ystem identification; systems biology.
Oscillatory biochemical networks ... at it considers positive and negative
interactions in a unified manner.
The implication o f the identification o f an oscillophoretic
subgraph is that if such a subgraph is found in a large
network, ... negative one-step influences (Eqn 9a) and
any number of positive one-step influences (Eqn 8). In other
words, if the number of Ôeven cyclesÕ in the combination is
even, this combination contributes to...
- 11
- 638
- 0
