ali aruna asaf c 1909 1996 indian resistance leader

Báo cáo sinh học: " Reduced expression of Jak-1 and Tyk-2 proteins leads to interferon resistance in Hepatitis C virus " docx

Báo cáo sinh học: " Reduced expression of Jak-1 and Tyk-2 proteins leads to interferon resistance in Hepatitis C virus " docx
Ngày tải lên : 18/06/2014, 18:20
... prototype Con1 sub-genomic replicon HCV RNA (Fig 1A) The HCV replicon is a dicistronic chimeric RNA which contains the gene encoding for neomycin phosphotransferase (conferring resistance to G-418) ... each cell line by treatment with Cyclosporine-A The success of Cyclosporine-A treatment and absence of HCV RNA in these cured cells was confirmed by RPA and immunostaining for HCV NS3 protein Cured ... IFN -resistance in these replicon cells since the cured cells prepared from each replicon still show reduced IFN signaling Interferon signaling in the cured cells was determined using a luciferase...
  • 13
  • 305
  • 0
  1. Khoa Học Tự Nhiên
  2. Hóa học - Dầu khí
báo cáo hóa học:"Differences in resistance mutations among HIV-1 non-subtype B infections: a systematic review of evidence (1996–2008)" pptx

báo cáo hóa học:"Differences in resistance mutations among HIV-1 non-subtype B infections: a systematic review of evidence (1996–2008)" pptx
Ngày tải lên : 20/06/2014, 08:20
... of emergence of resistance It is further conceivable that this diversity could affect the degree of cross -resistance to ARVs within a drug class The result could impact clinical outcomes (i.e., ... sufficient completeness Conference abstracts were searched These were: Conference on Retroviruses and Opportunistic Infections (1997–2008), Interscience Conference of Antimicrobial Agents and Chemotherapy ... conference abstracts, i.e., PUBMED (1996 2008), Web of Science (1996 2008), EMBASE (1996 2008), BIOSIS (1996 2008), AIDSLINE (1996 2005), OVID (1996 2008), Psychinfor (1996 2008), Cochrane controlled...
  • 11
  • 754
  • 0
  1. Khoa Học Tự Nhiên
  2. Hóa học - Dầu khí
Báo cáo sinh học: "Etiology and antibiotic resistance patterns of community-acquired urinary tract infections in J N M C Hospital Aligarh, India" potx

Báo cáo sinh học: "Etiology and antibiotic resistance patterns of community-acquired urinary tract infections in J N M C Hospital Aligarh, India" potx
Ngày tải lên : 08/08/2014, 19:20
... aeruginosa ATCC 27853, E faecalis ATCC 29212, E coli BCC 2132 (ESBL producer), and E coli ATCC 35218 (non-ESBL producer) were used as quality control strains Interpretative criteria for each antimicrobial ... Significant at p-value of < 0.05 * p value = 0.000 Ak = amikacin; Ao = aztreonem; C = chloramphenicol; Co = cotrimoxazole; Cpm = cefepime; Cep = cefpodoxime; Ca = ceftazidime; Ce = cephotaxime; Ci ... were those recommended by the NCCLS-2000 [14] ESBL Detection by NCCLS phenotypic method The NCCLS-ESBL phenotypic confirmatory test with ceftazidime, cephotaxime, ceftriaxone and cefixime were...
  • 7
  • 320
  • 0
  1. Luận Văn - Báo Cáo
  2. Báo cáo khoa học
Báo cáo y học: " Co-receptor tropism prediction among 1045 Indian HIV-1 subtype C sequences: Therapeutic implications for India" potx

Báo cáo y học: " Co-receptor tropism prediction among 1045 Indian HIV-1 subtype C sequences: Therapeutic implications for India" potx
Ngày tải lên : 10/08/2014, 05:21
... 5-CACCGGCTTAGGCATCTCCTATGGCAGGAAGAA-3 and reverse primer RP1: 5TAACCCTTCCAGGTACCCCCTTTTCTTTTA-3 The nested PCR was carried out with the forward primer, FP2: 5′-tgtaaaacgacggccagtCTGTTAAATGGCAGTCTAGC ... 5′-tgtaaaacgacggccagtCTGTTAAATGGCAGTCTAGC and reverse primer, RP2: 5′-caggaaacagctatgaccCACTTCTCCAATTGTCCCTCA Primers FP2 and RP2 contain the M13 universal primer sequence (lower case), which was used for population ... the Indian R5 tropic HIV-1 subtype C sequences including cohort Figure Consensus sequence logos of the Indian V3 sequences A HIV-1 subtype C CCR5-tropic strains (n = 1012), B Subtype C CXCR4tropic...
  • 6
  • 485
  • 0
  1. Luận Văn - Báo Cáo
  2. Báo cáo khoa học
Báo cáo y học: "High systemic levels of interleukin-10, interleukin22 and C-reactive protein in Indian patients are associated with low in vitro replication of HIV-1 subtype C viruses" docx

Báo cáo y học: "High systemic levels of interleukin-10, interleukin22 and C-reactive protein in Indian patients are associated with low in vitro replication of HIV-1 subtype C viruses" docx
Ngày tải lên : 12/08/2014, 23:23
... hepatocyte-stimulating factor Proc Natl Acad Sci USA 2000, 97:10144-10149 Montecucco F, Steffens S, Burger F, Pelli G, Monaco C, Mach F: C- reactive protein (CRP) induces chemokine secretion via CD11b/ICAM-1 ... Adolescents and Adults [42], which classifies patients on the basis of clinical conditions associated with HIV infection and CD4+ T- lymphocyte counts Clinical status and the CDC classification ... Definition for Adolescents and Adults Based on clinical categories; category C includes the clinical conditions listed in the AIDS surveillance case definition CDC Classification System & Expanded...
  • 15
  • 258
  • 0
  1. Luận Văn - Báo Cáo
  2. Báo cáo khoa học
Báo cáo y học: "Variations in autologous neutralization and CD4 dependence of b12 resistant HIV-1 clade C env clones obtained at different time points from antiretroviral naïve Indian patients with recent infection" doc

Báo cáo y học: "Variations in autologous neutralization and CD4 dependence of b12 resistant HIV-1 clade C env clones obtained at different time points from antiretroviral naïve Indian patients with recent infection" doc
Ngày tải lên : 13/08/2014, 01:20
... 5’TAGAGCCCTGGAAGCATCCAGGAAG-3’ as forward and 5’-TTGCTACTTGTGATTGCTCCATGT-3’ as reverse primer in the first round and 5’-CACCGGCTTAGGCATCTCCTATGGCAGGAAGAA-3’ as forward and 5’-TATCGGTACCAGTCTTGAGACGCTGCTCCTACTC-3’ ... 29 CCR5 3.J16/B PBMC 466 352 27 CCR5 3-3.J9/F1 PLASMA 459 352 28 CCR5 3-5.J25/F2 PLASMA 458 352 29 CCR5 3-5.J38/F2 NARI-IVC3 PLASMA 463 352 31 CCR5 CCR5 4.J2/B 462 352 30 PBMC 462 352 30 CCR5 ... 352 27 CCR5 11.J28/B 461 352 27 CCR5 PLASMA 458 352 28 CCR5 11-3.J9/F1 PLASMA 457 352 27 CCR5 11-3.J16/F1 PLASMA 457 352 26 CCR5 11-5.J12/F2 NARI-IVC11 PBMC 11-3.J3/F1 PLASMA 461 352 28 CCR5 †...
  • 15
  • 332
  • 0
  1. Luận Văn - Báo Cáo
  2. Báo cáo khoa học
Báo cáo y học: " Effects of the K65R and K65R/M184V reverse transcriptase mutations in subtype C HIV on enzyme function and drug resistance" pps

Báo cáo y học: " Effects of the K65R and K65R/M184V reverse transcriptase mutations in subtype C HIV on enzyme function and drug resistance" pps
Ngày tải lên : 13/08/2014, 05:21
... 5'-GGAAGGGTTAATTTACTCTAAGAAAAGGC-3' and CLTRPstIR 5'CTATCCCATTCTGCAGCCTCCTCA-3' and MJ4 DNA template; the http://www.retrovirology.com/content/6/1/14 resulting 0.9 kb fragment was subcloned into the pSP72 vector ... ATP-mediated primer unblocking were derived from the polypurine tract (PPT) of the HIV-1 genome [30] and were: 57D(5'GTTGGGAGTGAATTAGCCCTTCCAGTCCCCCCTTTTCTTTTAAAAAGTGGCTAAGA-3' 17D 5'-TTAAAAGAAAA ... significantly increased compared to that of WT (P ≤ 0.01) and Figure of WT and mutant RTs dNTP concentration dependence of single-cycle processivity dNTP concentration dependence of single-cycle...
  • 11
  • 255
  • 0
  1. Luận Văn - Báo Cáo
  2. Báo cáo khoa học
Báo cáo y học: "Molecular basis of telaprevir resistance due to V36 and T54 mutations in the NS3-4A protease of the hepatitis C virus" pdf

Báo cáo y học: "Molecular basis of telaprevir resistance due to V36 and T54 mutations in the NS3-4A protease of the hepatitis C virus" pdf
Ngày tải lên : 14/08/2014, 08:20
... HCVspecific primers (5'-ACG CAG AAA GCG TCT AGC CAT-3' and 5'-TAC TCA CCG GTT CCG CAG A-3'), an HCV-specific probe (5'-6FAM-TCC TGG AGG CTG CAC GAC ACT CA XT-PH-3), and an ABI Prism 7000 sequence detection ... HCV_1a HCV_1b HCV_ 1c HCV_2a HCV_2b HCV_ 2c HCV_2k HCV_3a HCV_3b HCV_3k HCV_4a HCV_5a HCV_6a HCV_6b HCV_ 6c HCV_6g HCV_6h HCV_6k : : : : : : : : : : : : : : : : : : 140 100 * 120 * * 160 * PCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGIFRAAVCTRGVAKAVDFIPVENL ... : Welsch et al R16.15 T54A/S β3 β1 HCV_1a HCV_1b HCV_ 1c HCV_2a HCV_2b HCV_ 2c HCV_2k HCV_3a HCV_3b HCV_3k HCV_4a HCV_5a HCV_6a HCV_6b HCV_ 6c HCV_6g HCV_6h HCV_6k Volume 9, Issue 1, Article R16...
  • 18
  • 396
  • 0
  1. Luận Văn - Báo Cáo
  2. Báo cáo khoa học
Architecture and Construction A.Ali C.A.Brebbia

Architecture and Construction A.Ali C.A.Brebbia
Ngày tải lên : 07/06/2015, 22:50
  • 223
  • 196
  • 3
  1. Kỹ Thuật - Công Nghệ
  2. Kiến trúc - Xây dựng
Theory and problems of programming with c++ 1996

Theory and problems of programming with c++ 1996
Ngày tải lên : 04/02/2016, 11:13
... each row in the block letter: #include ciostream.h> // Prints the block letter 'B' in a x grid: main0 tout CC '*****' CC endl; tout cc '* *' CC endl; tout cc '* *I CC endl; tout CC "*****' CC ... #include ciostream.h> #include climits.h> // Tests for overflow for type short: main0 short n = SHRT -MAX - 1; tout CC n++ CC endl; tout CC n++ CC endl; tout CC n++ CC endl; tout CC n++ CC endl; ... tout cc '* *' CC endl; tout cc '* *' CC endl; tout CC '*****' CC endl; return 0; Instead of adding the end1 object to each output, we could have endline character ‘\n' like this: tout CC "*****\n';...
  • 446
  • 959
  • 0
  1. Công Nghệ Thông Tin
  2. Kỹ thuật lập trình
HỘI NGHỊ KHOA HỌC về CHUYẾN KHẢO SÁT LIÊN hợp BIỂN ĐÔNG VIỆT NAM PHILIPPINES 1996

HỘI NGHỊ KHOA HỌC về CHUYẾN KHẢO SÁT LIÊN hợp BIỂN ĐÔNG VIỆT NAM PHILIPPINES 1996

Ngày tải lên : 06/08/2016, 14:42
  • 168
  • 583
  • 0
  1. Luận Văn - Báo Cáo
  2. Kỹ thuật
Phát huy nguồn lực nội bộ với 10-C

Phát huy nguồn lực nội bộ với 10-C
Ngày tải lên : 04/08/2012, 14:33
  • 4
  • 1.1K
  • 2
  1. Kỹ Năng Mềm
  2. Kỹ năng lãnh đạo
1500 Test C.pdf

1500 Test C.pdf
Ngày tải lên : 05/08/2012, 12:27
... rate c a chair c a look c b picture c lecture d furniture b how c cow d row b cough c although d rough b only c lone d bone b late c private d date b cheap c chemist d child b book c soon ... been coming c has come d has been coming a 29 I tried the bus, but I missed it a catching b to catch c catch d catch up >b 30 Women only began to gain with men in the 20th century a equalization ... Reagan > c 44 We can't reduce the number of nurses a cut back on b cut off on c cut out on d cut out a 45 Put on your coat just ………… it becomes cold a in fact b in time c in order d in case >...
  • 428
  • 2.5K
  • 11
  1. Ngoại Ngữ
  2. Chứng chỉ A, B, C
Bảo quản thực phẩm

Bảo quản thực phẩm
Ngày tải lên : 11/08/2012, 12:43
... phitin, têch ly c c axit hỉỵu c tỉì c c cacbuahydro dỉåïi t c dủng ca VSV, têch ly c c axit bẹo tỉû tỉì c c cháút bẹo dỉåïi t c dủng ca enzim phitaza C åìng âäü ca c c quạ trçnh ny tàng cng våïi ... th c â åí nhiãût âäü 40 0C v âäü áøm ca khäng khê l 80% Âäúi våïi cháút ca c c tia sạng, våïi c c tia sạng nhçn tháúy thç c c tia c bỉå c sọng ngàõn c t c dủng kêch thêch sáu hải mảnh hån c c ... quanh chäù c ạnh sạng Låi dủng âà c ny ta c thãø tiãu diãût âỉå c sáu hải kho 5/ T c dủng c hc : Sáu mt l nhỉỵng sinh váût c kêch thỉå c âạng kãø nãn chụng dãù bë chãút c c va chảm c hc lục...
  • 104
  • 870
  • 2
  1. Khoa Học Tự Nhiên
  2. Sinh học
Cấu tạo giải phẫu thực vật

Cấu tạo giải phẫu thực vật
Ngày tải lên : 11/08/2012, 12:45
... giải cho pectin làm cho tế bào rời Khi pectin tan nư c cho dung dịch giao trạng nhày cho acid pectic đ c thành ngưng giao (gélée) Pectin → acid pectic + CH3OH Acid pectic chuỗi g c giống glucoz, ... glucoz, acid d-galacturonic làm C c hợp chất pectin nghiên c u sử dụng c ng nghệ th c phẩm 1.4 Gôm chất nhầy C ng hợp chất hydrat carbon vách tế bào, c liên quan với hợp chất pectic c đ c tính ... dụng th c vật cho m c đích sơn, kiến tr c điêu kh c ? Gọi tên mô tả lãnh v c th c nghiệm vi c nghiên c u th c vật CHƯƠNG C U TR C CỦA TẾ BÀO TH C VẬT Từ khoá - Tế bào - Mạng nội chất - S c tố quang...
  • 199
  • 3.1K
  • 12
  1. Khoa Học Tự Nhiên
  2. Sinh học
Phụ gia thực phẩm

Phụ gia thực phẩm
Ngày tải lên : 11/08/2012, 12:48
... GÒN KHOA C NG NGHỆ TH C PHẨM CHƯƠNG DANH M C C C CHẤT PHỤ GIA TH C PHẨM TT Danh m c chất phụ gia Bộ Y tế(QĐ 3742/2001/ BYT ) Tên nhóm phụ gia th c phẩm Ch c năng, c ng dụng C c ch c kh c lượng ... phẩm thạch, E330: acid citric sản phẩm đồ uống c vò chua… C nhiều chất phụ gia mang tính chất ứng dụng kh c loại th c phẩm: chẳng hạn chất chống oxy hoá c chất tan dầu, c chất tan nư c, nhiên ... 422 Glycerol Glycerol Nhũ hóa, ổn đònh, làm dày 450 Canxi dihydro Calcium Điều chỉnh độ axit vii diphosphat Dihydrogen Diphosphate 16 C C CHẤT LÀM RẮN CH C 333 Canxi citrat Calcium Citrates Chống...
  • 165
  • 1.7K
  • 12
  1. Khoa Học Tự Nhiên
  2. Sinh học
Giáo trình thuốc bảo vệ thực vật

Giáo trình thuốc bảo vệ thực vật
Ngày tải lên : 11/08/2012, 13:00
... NG CHƯƠNG I C S ð C CH T H C NÔNG NGHI P Thu c BVTV m t ch t ñ c, nên chương cung c p cho h c viên nh ng khái ni m b n nh t v ch t ñ c, yêu c u c a ch t ñ c dùng nông nghi p phân lo i thu c BVTV ... n b c ng ngh gia c ng, ñóng gói, c ng ngh s n xu t ch t ñ n ph gia cho phép gia c ng ñư c nhi u d ng ch ph m m i, ñáp ng ñư c yêu c u qu n lý thu c BVTV ngày ch t ch c a qu c gia t ch c qu c t ... u h t thu c tr nh n thông d ng hi n ñ u c t c d ng ti p x c ð i ña s thu c nhóm nh ng thu c ñ c hi u c t c d ng di t nh n, c kh ch n l c cao, gây h i cho c n trùng c ích thiên ñ ch Nhi u lo...
  • 13
  • 3.5K
  • 37
  1. Khoa Học Tự Nhiên
  2. Sinh học
Công nghệ chế biến thực phẩm đóng hộp

Công nghệ chế biến thực phẩm đóng hộp
Ngày tải lên : 11/08/2012, 13:01
... quát C đ c làm b c nư c sản phẩm c ch đun sôi Quá trình c đ c sử dụng nhiều c ng nghiệp đồ hộp để sản xuất c chua c đ c, mứt, nư c cô đ c, loại soup khô, sữa đ c M c đích C đ c nhằm m c đích: ... Chần làm giảm chất c mùi vị không thích hợp vị đắng (măng, c tím) hợp chất lưu huỳnh (rau c i, c i bắp, gia c m) - Làm cho rau c màu sáng phá hủy số chất màu Khi chần dung dịch acid citric ... chế biến sauce số đồ hộp thịt, c - Đồ hộp nư c rau: C c loại đồ hộp nư c giải khát (c chứa nhiều chất dinh dưỡng) Đư c chế biến từ loại rau, c làm nư c uống 3.2 C c loại đồ hộp chế biến từ...
  • 127
  • 1.4K
  • 7
  1. Khoa Học Tự Nhiên
  2. Sinh học
Xem thêm