a3—requirements for test members p 355 2 17

Revision for test 3- p.71

Revision for test 3- p.71

... V-ed: The girl is Mai She is playing the piano The girl playing the piano is Mai The people are waiting for the bus in the rain They are getting wet The people waiting for the bus in the rain are ... on time come to come Do you mind If I asked you a private question? asked ask They happy looked at the children playing in the yard happy happily This is the first time I visited Ha Noi visited ... …………………………………… 6- Could you please give me some information about the English course, please? giving me some more informaton about the -Would you mind… English course? We must pay the bill at once -The...

Ngày tải lên: 04/05/2015, 07:00

11 425 0
Tài liệu Oxford Collocations Dictionary for students of English_ Chương 2.17 docx

Tài liệu Oxford Collocations Dictionary for students of English_ Chương 2.17 docx

... sales a missed sales opportunity I photo (= an opportunity to take photographs of famous or important people) I equal opportunities (= the principle of treating all people the same, regardless ... offered • PREP - for Thejob will offer you excellent opportunities for promotion at the earliest/first (possible) opportunity, at every (available) opportunity, equality of opportunity, the opportunity ... opportun- • PHRASES Please purchase PDF Split-Merge on www.verypdf.com to remove this watermark option 539 ity The ceasefire has created a window of opportunity to rescue the peace process oppose...

Ngày tải lên: 10/12/2013, 13:15

17 577 0
English 6- Revision for Test 2

English 6- Revision for Test 2

... bed eleven ten 11 bus brush lunch ruler 12 grade late face class Ex7: Give the correct form of verbs What time … ……… they (get)………… up? They (get) ………………up at six What your sister (do) after ... ……………Lan (listen) …………to music every evening? – No She (play) ……………….the piano Every morning I (get)……………… up at six and my sister (get) ………… up at six, too My brother and I often ( have) … … breakfast ... which is pronounced differently from others cooks plays lives learns breakfast eat read clean come soccer mother country city couch car coat three these weather with late name table lamp classes...

Ngày tải lên: 14/10/2013, 08:11

2 2.6K 17
English 7- Revision for Test 2

English 7- Revision for Test 2

... All kind of people: the old, the (1)…………………, everyone And why people read? For (2) ………variety of reasons Some for pleasure, and some for (3) ………………because they have to And when people (4) …… ………? ... in the world sport, how they became champions and about …… .… (9) plans for the future Television programs about ……… … …….(10) are also very popular, and you can watch something practically everyday ... comfortable armchair But watching sports events and going in for sports… ……(4) two different things Let’s hope that you prefer the second Sport holds …… (5) important place in our life When you listen...

Ngày tải lên: 14/10/2013, 08:11

2 2.2K 21
Revision for test 2(hot)

Revision for test 2(hot)

... experiments in Physics -> 10 What about go to the movies tonight? -> 11 Are there any picture on the wall? -> 12 I have no books English at home -> 13 He often practices play ... good English (at/ in /with /for) They are interested literature (on/ at/ in /for) All the students enjoy on the weekend (a to camp b camping c camp d to camping) Tim and Hoa are the same ... chemistry c physics) 17 It’s time lunch now (a at b for c to ) 18 Talking with friends is a common way of relaxing at recess (a good b popular c easy.) 19 Students are talking and playing excitedly...

Ngày tải lên: 18/10/2013, 03:11

4 634 3
Practice for test 2

Practice for test 2

... from her (appear) The principal gave a (speak ) to welcome the new students The seaside has a ( health ) climate He is a stamp (collect) Bell (success ) demostrated his invention 10 Mr Phong made ... train but I prefer ( fly) Before (go ) to bed , I often read a newspaper The weather was nice so I suggested (go) for a walk 10 I (stay) here untill he ( answer ) me 11 You (not forget ) to ... complete the sentences: best ago neighbor uniform friendship carefully made at in last in I was born in Africa ……… 1970 I bought a car a few weeks…………… I didn’t go home …………… weekend It happened...

Ngày tải lên: 22/10/2013, 16:11

2 431 0
TEST FOR THE FIRST TERM( BOOK 2)

TEST FOR THE FIRST TERM( BOOK 2)

... marks) 1.A August 2. D.candy 3.C.ruler 4.B Monday II Choose the right words to fill in the blank (2 marks) these 2. are 3.on 4.Music III Select and tick the letter A, B or C(2marks) 1.C 2. B 3.A 4.B 5.B ... lessons? We learn to read and write in Vietnamese V Write the answers (2marks) 1.There are ( forty students in my class.) 2. My favourite subject is ( English.) 3.(I like English because I want ... to read and write in Vietnamese V Write the answers (2marks) 1.How many students are there in your class? …………………………………………………………………………………………… 2. What is your favourite subject ? ……………………………………………………………………………………………...

Ngày tải lên: 28/10/2013, 13:11

2 1.3K 4
iec 60269-2-1 low-voltage fuses - supplemetary requirements for fuses for use by authorized perso

iec 60269-2-1 low-voltage fuses - supplemetary requirements for fuses for use by authorized perso

... :7EE75 NJH7035 J5 62tj5 2E25 N23D8D275 H43G5 675 HS7GGJD5 605 I40N4D35 675 :40I0375 675 HS2H 2179 E5 67 371IHJ: 7179 E5JOJ9E5H75:403J9E5JGGDP 925 H75IH0G52H7N25I4035HJ5EJDHH75:49GD 623 27T f1]1]1)1)// [+4@-4+,+-./*3/C34+567 ... \0GD;H7G5JN7:52H 2179 EG5675371IHJ: 7179 E5j5IHJED97G *7:ED495&&&A \0GD;H7G5JN7:52H 2179 EG5675371IHJ: 7179 E5j5:JIG0H7G5:OHD963DM07G *7:ED495&VA \0GD;H7G5JN7:52H 2179 EG5675371IHJ: 7179 E5j5:40E7J0X562I43E2G *7:ED495VA ... 1J9DI0HJED49R5GJEDG8JDGJ9E5J0X594317G56D179GD4997HH7G5D96DM 027 G56J9G5H7G58DP037G5@h&zi57E5,h&z iT

Ngày tải lên: 25/12/2013, 10:47

264 753 4
iec 60269-2 low-voltage fuses - supplementary requirements for fuses for use by authorized person

iec 60269-2 low-voltage fuses - supplementary requirements for fuses for use by authorized person

... the prokction o semiconductordevices f 28 2- High-voltagefuses P r 1: Current-limiting fuses at 28 2-1 (1994) 28 2 -2 (1995) Partie Coupe-circuit expulsion 28 2 -2 (1995) P r 2: Expulsion fuses at 28 2-3 ... message: please call the Document Policy Group at 303-397 -22 95 D YBYY89L Ob0 329 5 322 hblications de la CE1 prộparộes par le Comitộ d'Etudes no 32 127 : 127 -2 (1989) 127 -3(1984) Premiốre partie: ... Requirements (Publication 26 9-1) Supplementary Requirements for Fuses for Use by Authorized Persons (Fuses Mainly for Industrial Application) (Publication 26 9 -2) - Part 2- 1: Examples of Types of Standardized...

Ngày tải lên: 25/12/2013, 10:53

30 315 3
iec 60439-2 low-voltage switchgear and controlgear assemblies - particular requirements for busba

iec 60439-2 low-voltage switchgear and controlgear assemblies - particular requirements for busba

... température de +20 OC,par mètre de longueur: - phase phase - ßbO phN phase neutre - ßbO phPEN phase PEN - - ßbO phph ßbO phPE phase PE la résistance ohmique moyenne des conducteurs considérés, pour ... considérés, pour le courant assigné INc, la fréquence assignée f , par mètre de longueur: - xb phph phase phase - xb phN phase neutre - Xb phPEN phase PEN - Xb phPE phase PE NOTE Ces valeurs peuvent ... 60439 -2 O IEC :20 00 8 .2. 10 .2. 1 The tests described in 8 .2. 10.1.1 shall be performed with the mass 8 .2. 10 .2. 2 The test described in 8 .2. 10.1 .2 shall be performed with the mass Ml = m, 8 .2. 1 0.3...

Ngày tải lên: 25/12/2013, 11:05

74 824 14
Báo cáo khoa học: Structural requirements for the apical sorting of human multidrug resistance protein 2 (ABCC2) potx

Báo cáo khoa học: Structural requirements for the apical sorting of human multidrug resistance protein 2 (ABCC2) potx

... (1510–1545) GFP–MRP2 GFP–MRP2D7 GFP–MRP2D11 GFP–MRP2D15 GFP–MRP2D20 GFP–MRP2D25 GFP–MRP2D25 MAKE GFP–MRP2D50 GFP–MRP2D100 73 69 65 16 15 1 18 18 20 17 64 59 59 64 35 13 15 67 20 33 32 35 65 GKIIECGSPEELLQIPGPFYFMAKEAGIENVNSTKF ... Construct % Apical % Vesicles % ER C-Terminal sequence (1516–1545) GFP–MRP2 GFP–MRP2D3 GFP–MRP2-T1543A GFP–MRP2D15 GFP–MRP2D15TKF 73 64 67 16 21 18 13 16 17 21 23 17 67 58 GSPEELLQIPGPFYFMAKEAGIENVNSTKF ... membrane proteins such as DPPIV and MRP2 [ 42] To assess the validity of DPPIV as a marker for polarity, HepG2 cells were double-stained for DPPIV and MRP2 The majority (98.9%) of DPPIV-positive,...

Ngày tải lên: 31/03/2014, 09:20

11 523 0
review for test 2-10

review for test 2-10

... being popular b is still popular c is still going to be popular d will still popular IV Identify the one underlined word or phrase A, B, C or D - that be changed for the sentence to be correct 26 ... and I think her latest is the best a made b had made c has made d was making 20 The film again by popular request a is showing b has shown c is being shown d is shown 21 people trying to get ... finally satisfied 24 My music teacher urged me the violin even though I was having such a hard time with it a not to give up b not give up c didn't give up d no giving up 25 There is every reason...

Ngày tải lên: 13/07/2014, 04:00

2 815 4
Procedures for ASME Performance Test Code Committees phần 2 pptx

Procedures for ASME Performance Test Code Committees phần 2 pptx

... Group Membership Approve membership of the subordinate groups reporting to it PTC COMMITTEE ACTIONS PTC committee actions are of three types: (a) Approval of standards actions (see Article 6 .2) ... for the implementation of the proposal is urgent the proposal is very unlikely to have opposition, such as for editorial proposals, updating edition dates for referenced standards, and incorporation ... of the PTC Document 5.1.9 Due Process Provide for procedural due process 5.1.10 Oversee the Assignment of Project Teams At appropriate stages of the development process, the Project Team provides...

Ngày tải lên: 08/08/2014, 13:20

9 237 0
for test term 2 (2016)

for test term 2 (2016)

... a laptop before - It is the first time I have (ever) used a laptop 12 Has any one ever operated this TV with a remote control before? Has this TV ever been operated with a remote control before? ... high price Because the color TV was expensive, we didn’t buy it 17 Although the internet has some bad effects, more and more people use it In spite of having some bad effects, more and more people ... win the 20 10 World Cup - It is likely that Brazil will win the 20 10 World Cup 35 He plays the guitar for a small group so that he can earn some extra money To earn some extra money he plays the...

Ngày tải lên: 28/04/2016, 15:02

2 135 0
FOR TEST TERM 2 E9 2016

FOR TEST TERM 2 E9 2016

... watches 12 A sun B hungry C pull D supper 13 A television B pressure C pleasure D leisure II Each sentence has a mistake Find and correct it She is very pride of her father and love him so much proud ... I Pick out the word whose underlined part is pronounced differently (KEY) A food B soon C good D too A though B enough C cough D rough A pond B post C ghost D go A compulsory B dull C pull ... her lazy laziness 10 Provided you go now, you aren’t late for the train Won’t be III Reading * Use the words in the box to complete the passage In the Unites States, people celebrate Mother’s...

Ngày tải lên: 28/04/2016, 21:00

2 144 0
w