... GAGGAGAAGCCCGGTTATGTTTTGCAACAGATACCACACTGGGAATT GTTACAGCATTTACAGCAGAAGATGCAGATGGGGAAGTTGGTGTCCA GACGACGACAAGATGGACACCCACTTCCCGATCTGCATTTTCTGCTG CGGCTGCTGTCATCGATCAAAGTGTGGGATGTGCTGCAAGACGTAA GAGGAGAAGCCCGGTTACGTCTTGCAGCACATCCCACACTTTGATCG ... and (c) S-huhepc enterokinase digestion to generate huhepc For GACGACGACAAGATGGACACCAACTTCCCCATCTGCATCTTCTGCTG TAAATGCTGTAACAATTCCCAGTGTGGTATCTGTTGCAAAACATAA GAGGAGAAGCCCGGTTATGTTTTGCAACAGATACCACACTGGGAATT ... GAGGAGAAGCCCGGTTACGTCTTGCAGCACATCCCACACTTTGATCG ATGACAGCAGCCGCAGCAGAAAATGCAGATCGGGAAGTGGGTGTCCA MDTNFPICIFCCKCCNNSQCGICCKT MDTHFPICIFCCGCCHRSKCGMCCKT GSGMETAAKPERQHMDSPDLGTDDDDKMDTNFPICIFCCKCCNNSQCGICCKT GSGMETAAKPERQHMDSPDLGTDDDDKMDTHFPICIFCCGCCHRSKCGMCCKT...
Ngày tải lên: 18/02/2014, 18:20
... potato per person THE BAKED POTATO BANANA SPLITSVILLE Basic Caramel Software: cups sugar cup water tablespoon light corn syrup Caramel Sauce Software: batch caramel cups heavy cream Banana Brulee ... Brulee Software: bananas Sugar for coating Additional Splitsville Software: Ice cream of your choice Hardware: Small, heavy saucepan Clean soup spoon Candy thermometer Parchment paper sheet pans ... COFFEE: BLACK, NO CHASER 19 Good Eats! A Treasury Of Favorite Recipes When purchasing a coffee maker (either manual or electric), look for a model that brews into a thermal carafe rather than...
Ngày tải lên: 03/05/2014, 10:27
a treasury of sanskrit poetry
... From Subhashila Ratnakosha 87 The Traveller at the Well 110 88 Forest Fire 111 xvi A Treasury of Sanskrit Poetry D1VAKARA From Surngadhara Paddhati 89 The Spread of Fame 12 AMARU Amarusataka 90 Love ... KSHEMIsv ARA Chandakausika 143 The Sacrificial Tree 150 SIDDHA Upamitibhavaprapancha Kathii 144 The Beggar Unmeritorious 15 ANANTA From Siirngadhara Paddhati 145 The Poet's Fame 152 KALASAKA From ... Chhiindogya 20 Upanishad You are That 21 Taittiriya Upanishad 21 Learn and Teach Munqaka 22 21 Upanishad Two Birds 22 VYASA Mahiibhiirata 23 The Humiliation of Draupadi 23 24 Death of Abhimanyu 28...
Ngày tải lên: 04/05/2014, 15:35
Application of biologically active micelles in drug delivery across the blood brain barrier
... administration of LPS in mice, so the neuroprotection can be achieved with nigral administration of an anti-IL-1ȕ neutralizing antibody (Arai et al., 2004; Arai et al., 2006) There are many anti-inflammatory ... eliminate them They have been administrated for several decades, and are capable of sterilizing the cerebral spinal fluid (CSF) in a relatively rapid and reliable way Antibiotics that are effective ... Ciprofloxacin and Penicillin are two typical broad-spectrum antibiotics commonly used Ciprofloxacin is mainly against Gram-negative bacteria and Penicillin is usually against Gram-positive bacteria...
Ngày tải lên: 11/09/2015, 09:10
The roles of biologically active gasotransmitters (NO and h2s) in myocardial ischemia reperfusion
... Yilong Jan 25th, 2008 ii LIST OF ABBREVIATIONS AAR Area at Risk AMI Acute Myocardial Infarction ASA Acetylsalicylic acid (aspirin) BCA β-cyano-L-alanine BH4 Tetrahydrobiopterin BW Body Weight CABS ... ester linkage The chemical structures of NOParacetamol and paracetamol are listed in Figure 1.4 Paracetamol NO-Paracetamol Figure 1.4 Chemical structures of paracetamol NO-Paracetamol Compared with ... Rat 91 3.3.1 Effects of paracetamol and NO-Paracetamol on systemic BP and HR 91 3.3.2 Effects of paracetamol and NO-Paracetamol on infarct size 94 3.3.3 Effects of paracetamol and NO-Paracetamol...
Ngày tải lên: 11/09/2015, 16:07
A three phase voltage type PWM rectifier with the function of an active power filter
... term of the n -th harmonic component of i,, Though the AC components are also contained in the output signal of the integrator, they can be made small by the integral action of the integrator and ... KataokaT 1996, nt-type PWM rectifier with active filtering function", IEEJ SPC- 96 (107), 11-20 ( in Japanese) KataokaT, Murota 1, Fuse Y, Nakajima D and Nishikata S 1999, A Single-phase Voltage-Type ... sinusoidal waveform in compliance with the sinusoidal reference signal and , that the current i has a nearly rectangular waveform due to the existence of a smoothing reactor Fig3(b) shows the waveform...
Ngày tải lên: 03/01/2014, 19:44
Tài liệu Báo cáo khoa học: Physico-chemical characterization and synthesis of neuronally active a-conotoxins docx
... Mass Methods Reference v v v m m m v v v p m m m a7 N /A a7 a3 /b4 (less active) (less active) a3 /b2, a7 a3 /b2, a7 a3 /b2, a7 a3 b2; a6 b2b3 a3 b2 /a3 b4; a7 a3 a7b4 /a3 a5b4 a3 b2 a a7 a a7 a a3b2 a3 b2 a6 b2b3 ... characterization of native a- conotoxins Analysis of neuronally active a- conotoxins using HPLC and MS, including identification of post-translational modifications Isolation and identification Standard ... example, asparagine to aspartic acid, or glutamine to glutamic acid changes [14] The a- conotoxins EpI, PnIA, GIC, GID, AnIA and AnIB contain pairs of asparagine residues [5,10,21,23,24] (Table...
Ngày tải lên: 19/02/2014, 12:20
Tài liệu Báo cáo khoa học: Models and mechanisms of O-O bond activation by cytochrome P450 A critical assessment of the potential role of multiple active intermediates in oxidative catalysis doc
... Wada, A. , Ogo, S., Watanabe, Y., Mukai, M., Kitagawa, T., Jitsukawa, K., Masuda, H & Einaga, H (1999) Synthesis and characterization of novel alkylperoxo mononuclear iron(III) complexes with a ... dismutase or catalase, implicating the involvement of a peroxo adduct in catalysis [243] In fact, reactivity was enhanced when H2O2 was the oxidant in place of reductant and air [243], and the putative ... iron-peroxy adduct prone to fragmentation [266] A similar paradigm also appears to apply to the nal step in aromatase (CYP19)-catalyzed biotransformation of androgens to estrogens [267] As illustrated...
Ngày tải lên: 19/02/2014, 16:20
Tài liệu Báo cáo khoa học: Site-directed mutagenesis of a loop at the active site of E1 (a2b2) of the pyruvate dehydrogenase complex A possible common sequence motif docx
... mutant E1 In all assays, the E1aS283C and E1aF26 6A mutants behaved essentially the same as wild-type E1 In the DCPIP assay, the E1aY28 1A and E1aR28 2A mutants displayed a catalytic activity about ... Kinetic parameters of wild-type and mutant E1s determined by the DCPIP assay Pyruvate ThDP kcat (s)1) Wild-type E1aF26 6A E1aR26 7A E1aD27 6A E1aY28 1A E1aR28 2A E1aS283C E1aY28 1A/ R28 2A/ S28 3A E1aY28 1A/ R28 2A ... that of wild-type E1; mutants with a replacement of E1aY281 tended to lose catalytic activity at a slightly lower temperature than mutants retaining that residue The E1aR26 7A mutant displayed a...
Ngày tải lên: 20/02/2014, 23:20
Báo cáo khoa học: The changing patterns of covalent active site occupancy during catalysis on a modular polyketide synthase multienzyme revealed by ion-trap mass spectrometry pptx
... N A 0a 0a N A N A 58 4 9a 2 8a a Methylmalonyl-CoA Malonyl-CoA Propionyl-CoA; methylmalonyl-CoA; NADPH Butyryl-CoA; methylmalonyl-CoA; NADPH Valeryl–CoA; methylmalonyl-CoA; NADPH Propionyl-CoA; ... 189–195 Holzbaur IE, Ranganathan A, Thomas IP, Kearney DJ, Reather JA, Rudd BA, Staunton J & Leadlay PF (2001) Molecular basis of Celmer’s rules: role of the Changing patterns of covalent active- site ... spheres of appropriate size These domains are sited away from the axis of the proposed structure to free up a central passage The pair of ACP domains can now make contact with the pair of KS domains...
Ngày tải lên: 16/03/2014, 03:20
Báo cáo khoa học: "A Combination of Active Learning and Semi-supervised Learning Starting with Positive and Unlabeled Examples for Word Sense Disambiguation: An Empirical Study on Japanese Web Search Query" pdf
... in table Human labeling, abbreviated as human, is an active learning approach starting with human labeled negative examples The number of hu- 63 man labeled negative examples in initial training ... unlabeled examples is effective The accuracies of with-EM, random and without-EM are gradually increasing according to the percentage of added hand labeled examples and catch up that of human and ... Behavior of Active Learning for Word Sense Disambiguation, Proc of the main conference on Human Language Technology Conference of the North American Chapter of ACL, pp 120-127 McCallum, A and...
Ngày tải lên: 23/03/2014, 17:20
Báo cáo khoa học: Expression and characterization of cyanobacterium heme oxygenase, a key enzyme in the phycobilin synthesis Properties of the heme complex of recombinant active enzyme potx
... Ishikawa, A. , Kawashima, K., Kimura, T., Kishida, Y., Kohora, M., Matsumoto, M., Matsuno, A. , Muraki, A. , Nakazaki, N., Shimpo, S., Sugimoto, M., Takazawa, M., Yamada, M., Yasuda, M & Tabata, S ... G.C., Katakura, K., Tomita, T., Zhang, X., Sun, D., Sato, M., Sasahara, M., Kayama, T., Ikeda-Saito, M & Yoshida, T (2000) Histidine 20, the crucial proximal axial heme ligand of bacterial heme ... 35 Kaneko, T., Tanaka, A. , Sato, S., Kotani, H., Sazuka, T., Miyajima, N., Sugiura, M & Tabata, S (1996) Sequence analysis of the genome of the unicellular cyanobacterium Synechocystis sp Strain...
Ngày tải lên: 23/03/2014, 20:22
Báo cáo " A combination of the identification algorithm and the modal superposition method for feedback active control of incomplete measured systems " doc
... Conference on Mathematics, Mechanics, and Informatics, Hanoi, 7/10/2006, on the occasion of 50th Anniversary of Department of Mathematics, Mechanics and Informatics, Vietnam National University, Hanoi ... as a vertical cantilever beam as showed in Fig Fig Model of a cantilever beam subjected to base acceleration The characteristics of the beam are taken from [12] The beam has a square cross-section ... separation of variables, the governing partial differential equation of the beam is represented by a system of infinite ordinary differential equations After that, the system of infinite equations...
Ngày tải lên: 28/03/2014, 13:20
Báo cáo " A combination of the identification algorithm and the modal superposition method for feedback active control of incomplete measured systems" doc
... Conference on Mathematics, Mechanics, and Informatics, Hanoi, 7/10/2006, on the occasion of 50th Anniversary of Department of Mathematics, Mechanics and Informatics, Vietnam National University, Hanoi ... as a vertical cantilever beam as showed in Fig Fig Model of a cantilever beam subjected to base acceleration The characteristics of the beam are taken from [12] The beam has a square cross-section ... separation of variables, the governing partial differential equation of the beam is represented by a system of infinite ordinary differential equations After that, the system of infinite equations...
Ngày tải lên: 28/03/2014, 13:20
Báo cáo khoa học: "Measurement and modelling of the photosynthetically active radiation transmitted in a canopy of maritime pine P Hassika" doc
... photosynthetically active radiation (PAR) of the solar spectrum (Sinclair and Lemon, 1974; Sinclair and Knoerr, 1982; Pukkala et al, 1991) Other teams (Alados et al, 1995 ; Papaioannou et al, 1996) have ... from transmittance of the sun’s beam Agric For Meteorol 55 Lang ARG (1991) Application of some of Cauchy’s theorems to estimation of surface areas of leaves, needles and branches of plants, and ... terms of the radiation balance in the PAR above and below the canopy for clear weather (day 193) as a function of the hour of the day The transmission of the incident PAR varies with the solar elevation...
Ngày tải lên: 09/08/2014, 04:20
báo cáo khoa học: "IsoBED: a tool for automatic calculation of biologically equivalent fractionation schedules in radiotherapy using IMRT with a simultaneous integrated boost (SIB) technique" ppt
... Conception and design: VB, MB and LS Development of software: VB and MP Analysis and interpretation of the data using IsoBED: AA, LS, MP and VB Drafting of the manuscript: VB, AA, MB and LS Final approval ... MA, Arcangeli G, Benassi M, d’Angelo A, Pinzi V, Caterino M, Rinaldi M, Ceribelli A, Strigari L: Hypofractionated Conformal Radiotherapy (HCRT) for Primary and Metastatic Lung Cancers with Small ... JA, Lichter AS, Martel MK, Ten Haken RK: Radiation pneumonitis as a function of mean lung dose: an analysis of pooled data of 540 patients Int J Radiat Oncol Biol Phys 1998, 42:1-9 Marks BLawrence,...
Ngày tải lên: 10/08/2014, 10:21
báo cáo khoa học: "Isolation of specific and biologically active peptides that bind cells from patients with acute myeloid leukemia (AML)" doc
... conformation Mutation of one of the amino acids may alter the binding properties and/or biological activity An internal arginine residue (large and polar) of peptide HP -A2 (IEETARKG) was replaced ... Table is a summary of clinical characteristics and biological activity induced by at least one peptide for each individual patient As seen in Figure for example, 40% of 15 AML patients incubated ... minutes at room temperature and washed again Alternatively, cytospin preparations of cells were fixed in 3.7% paraformaldehyde and kept at -80°C for further study The fluorescent signal was analyzed...
Ngày tải lên: 10/08/2014, 22:20
báo cáo khoa học: "SMI of Bcl-2 TW-37 is active across a spectrum of B-cell tumors irrespective of their proliferative and differentiation status" pptx
... associated with activation of caspase and 9, cleavage of the polyadenosine ribose polymerase (PARP) into active fragments and DNA fragmentation (Fig 3) These are the hallmarks of mitochondrial dependent ... cleavage and DNA fragmentation Exposure of WSU-FSCCL cells to TW-37 induced activation of caspase and caspase activity and PARP cleavage Page of 13 (page number not for citation purposes) Journal of ... overall project direction; YS technical work; ASG data interpretation; ASA technical work; BC data interpretation; AA technical work; RMM design of research experiments, data analysis All authors...
Ngày tải lên: 10/08/2014, 22:20
Báo cáo y học: "Evaluation of a system of structured, pro-active care for chronic depression in primary care: a randomised controlled trial" potx
... II; DSM IV: Diagnostic and Statistical Manual of Mental Disorders, 4th edition; WASAS: Work and Social Activity Scale; SAPAS: Standardised Assessment of Personality - Abbreviated Scale; CSRI: Client ... Random allocation of diary periods means that data can be imputed for the whole trial period and used as a patient record of their depression free days, as well to validate the scores calculated ... perceived as a ‘normal, mature person drawing on their own experience’, rather than with a mental health professional Practice nurses had more time than GPs, gave Page of helpful, practical advice and...
Ngày tải lên: 11/08/2014, 16:22
Báo cáo y học: "Prevalence of plasmodium falciparum in active conflict areas of eastern Burma: a summary of cross-sectional data" pptx
... Deployment of Early Diagnosis and Mefloquine- Artesunate Treatment of Falciparum Malaria in Thailand: The Tak Malaria Initiative PLoS Med 2006, 3(6):e183 Shanks GD, Karwacki JJ, Singharaj P: Malaria in ... Petit A, Lynam AJ, Johnson A, Hien TT, McGready R, Farrar JJ, Looareesuwan S, Day NP, Green MD, White NJ: Fake antimalarials in Southeast Asia are a major impediment to malaria control: multinational ... took primary responsibility for data management, and assisted in analysis and interpretation of the data and revision of the manuscript CL participated in design of the malaria program and cluster...
Ngày tải lên: 13/08/2014, 13:21