a treasury of biologically active
A facile friedel crafts acylation method using imidazolium cations ionic liquids as green solvents for synthesis of biologically active compounds
... Microwave-assisted acylation of aromatic compounds using carboxylic acids and zeolite catalysts J Mol Catal A: Chem 2010, 327, 80-86 94 Chandra Shekara, B M.; Jai Prakash, B S.; Bhat, Y S., Microwave-induced ... deactivation-free catalytic activity of BEA zeolite in acylation reactions J Catal 2012, 290, 101-107 95 Yadav, G D.; Bhagat, R D., Experimental and theoretical analysis of Friedel– Crafts acylation ... heteropoly acids Kinet Catal 2003, 44, 175-182 114 Martínez, F.; Morales, G.; Martín, A. ; van Grieken, R., Perfluorinated Nafionmodified SBA-15 materials for catalytic acylation of anisole Appl Catal A:
Ngày tải lên: 23/01/2021, 11:05
Synthesis, spectral characterisation, electrochemical, and fluorescence studies of biologically active novel Schiff base complexes derived from E-4-(2-hydroxy-3-
... physical characteristics and microanalytical data of the ligand and metal complexes are given in Tables and Table Physical characteristics of Schiff base ligand and complexes S no 522 Ligand/ ... 38,39 Various gram-positive and gramnegative bacterial organisms such as gram-negative bacteria Pseudomonas aeruginosa and E coli, gram-positive bacteria Staphylococcus aureus and Klebsiella aerogenes, ... Mirkhani, V.; Moghadam, M.; Tangestanninejad S.; Baltork, M P.; Rasouli N Catal Commun 2008, 9, 219–223 529 GOVINDARAJ and RAMANATHAN/Turk J Chem Bera, P.; Saha, N.; Kumar, S.; Baneeja, D.; Bhattacharya,
Ngày tải lên: 12/01/2022, 23:11
A Treasury of Proverbs and Folktales in Chinese and English
... the Illustrator Yang Xi 杨熙 is an up-and-coming artist and illustrator in China Her distinctive style can be characterized as an amalgamation of classical and contemporary, Chinese and Western ... professor of Chinese language and literature for over four decades She has taught at Oberlin College and Indiana University, and has directed various Chinese language study-abroad programs in Taipei, ... countries and peoples of Asia The world is a smaller place today and Asia’s economic, cultural and political influence has expanded, yet the need for meaningful dialogue and information about this
Ngày tải lên: 19/10/2022, 02:40
a model of knowledge representation for active collaborati
... dụng trong nhiều tài liệu khoa học với các ý ngh a, cách dùng khác nhau như: Concept Map (Joseph D Novak, 1977) [75], Conceptual Graph (John F Sowa, 1984), Knowledge Graph Theory (Cornelis Hoede, ... - Learning Object Metadata Trong... nghệ, lại v a mang tính sư phạm để ″bù đắp″ sự ″thiếu hụt″ giao tiếp gi a giáo viên với học viên trong môi trường trực tuyến [22][51] Nhận biết tầm quan trọng ... [29][84], IEEE-LOM/Learnativity... Hình 2.12 Khai thác e-Course trong các ngữ cảnh khác nhau c a lớp học 88 Hình 3.1 Cấu trúc tổng quát c a Learner Profile 100 Hình 3.2 Minh h a cách tiếp cận
Ngày tải lên: 07/11/2014, 17:25
phosphatidylserine exposure in red blood cells: a suggestion for the active role of red blood cells in blood clot formation
... 143 Acknowledgment 144 iv Abbreviations Abbreviations ABC transporter a. u aa AChE ADP AFM AM ANOVA APLT APS ATP BCECF BLAST BLASTp CCD CD cDNA CFTR DMSO EC ECL EDTA EGTA FACS FITC ... 230 Kawakami, S., Kaibara, M., Kawamoto, Y., Yamanaka, K., Rheological approach to the analysis of blood coagulation in endothelial cell-coated tubes: activation of the intrinsic reaction on ... effect was paralleled by RBC shrinkage, which was apparent on the basis of the decrease in forward scatter of FACS analysis [110] Caspases are a family of cysteine proteinases involved
Ngày tải lên: 15/11/2015, 12:54
Haksar, AND treasury of sanskrit poetry in english translation, a
... With a continuing tradition of at least three millennia, the vast literature of Sanskrit forms an important part of India's cultural heritage Translations from Sanskrit classics like Shakuntala ... copyright: Sahitya Akademi New Delhi for excerpts from Chandra Raj an The Complete Works ofKalidasa Vol I, and V Raghavan "Kalividambana", Indian L it erature June 1970; Bennet Coleman Co Ltd., ... translated by a galaxy of distinguished sch olars and writers Indian and foreign, incl udi ng famous names such as Sri Aurobindo and Swami Vivekananda, and Nobel Prize Poets Octavio Paz and William Butler
Ngày tải lên: 25/02/2019, 10:36
Design, synthesis and anticancer activity of some novel thioureido-benzenesulfonamides incorporated biologically active moieties
... incorporated biologically active moieties Mostafa M. Ghorab1,2*, Mansour S. Alsaid1, Mohamed S. Al‑Dosary1, Yassin M. Nissan3 and Sabry M. Attia4 Abstract Background: Many thiourea derivatives have ... Manjula SN, Noolvi NM, Parihar KV, Manohara Reddy SA, Ramani V, Gadad AK, Singh G, Gopalan Kutty N, Mallikarjuna Rao C (2009) Synthesis and antitumor activity of optically active thiourea and their ... posses a wide range of biological activity including antibacterial, anticonvulsant, anti-inflammatory and anticancer activity [19–22] The mechanism of anticancer activity may involve a wide range of
Ngày tải lên: 29/05/2020, 14:11
Cyclodextrin-active natural compounds in food applications: a review of antibacterial activity
... on a variety of bacteria and fungi [95] Even though rosemary essential oils acted as flavoring agents and antibacterial agents in food, their thermal stability restrains the range of application ... synthesized materials to impart better antibacterial effects [54,117] Related studies also have exhibited that linalool has antibacterial, antiinflammatory, local anesthetic, analgesic and antitumor ... Conclusion and future prospect Many natural active substances with significant antibacterial activity have been employed, and they are promising natural antibacterial drugs These active substances have
Ngày tải lên: 13/01/2022, 00:26
effects of highly active antiretroviral therapy and its adherence on herpes zoster incidence a longitudinal cohort study
... not change between the pre-HAART era and the HAART era, and that being on HAART was associated with a high risk of HZ [16] Furthermore, there are anecdotal reports of failure of antiretroviral therapy ... before her HAART initiation to a visit of a HAART naïve participant with similar propensity score (±0.1%) For any HAART naïve participant already selected as a control, the rest of her visits ... background covariates were similar between the matched pairs at the index visit The participants had a mean age around 39 years old, and about 61% of them were Black and 22% were Latina No significant
Ngày tải lên: 02/11/2022, 09:21
Báo cáo khoa học: Effects of replacing active site residues in a cold-active alkaline phosphatase with those found in its mesophilic counterpart from Escherichia coli
... stability and activity in a reciprocal manner Mutations in a cold -active alkaline phosphatase –1 –1.5 Results 45 °C Heat stability of the active site conformation The rate of heat inactivation was determined ... nucleic acids Proc Natl Acad Sci USA 81, 6691–6695 Mutations in a cold -active alkaline phosphatase 37 Pace CN (1986) Determination and analysis of urea and guanidine hydrochloride denaturation ... substrate affinity and lower overall reaction rates The Lys274 and Asp116 ⁄ Lys274 mutants also displayed an increase in global heat stability, which may be due to the formation of a stabilizing salt
Ngày tải lên: 15/07/2023, 19:01
Howto Books The A-Z Of Correct English
... inter-/intraand many others vii A abandon abandoned, abandoning, abandonment (not -bb-) abattoir (not -bb-) abbreviate abbreviated, abbreviating, abbreviation (not -b-) abbreviations See -able/-ible Adjectives ... good faith for general guidance and no liability can be accepted for loss or expense incurred as a result of relying in particular circumstances on statements made in the book Laws and regulations ... which has been written for the student and the general reader It aims to tackle the basic questions about spelling, punctuation, grammar and word usage that the student and the general reader are
Ngày tải lên: 05/10/2012, 09:46
Oxford University Press A Handbook Of Classroom English
... 1 56 A BEGINNING OF LESSON e Check the following simple clothing vocabulary: | a coat a cap (a pair of) | gloves an overcoat a hat araincoat a fur hat ananorak = a scarf boots ski-boots Also ... formal grammatical explanations, for example, teachers should feel free to use the L1 Naturally, an attempt can first be made in the L2, followed by an L1 translation This method has the advantage ... now, Alison See you again on Tuesday Pll see you (all) again next Wednesday See you tomorrow afternoon again I'll be seeing some of you again after the break Til see you all again after Christmas/next
Ngày tải lên: 05/10/2012, 09:53
Intelligent Software Agents on the Internet: an inventory of currently offered functionality in the information society & a prediction of (near-)future developments
... Software agents are a rapidly developing area of research However, to many it is unclear what agents are and what they can (and maybe cannot) In the first part, this thesis will provide an overview ... information that have changed rapidly in the last few years are the amount that it is available in, the number of sources and the ease with which it can be obtained Expectations are that these ... very hard to get a clear picture of the size of the Internet, let alone to make an estimation of the amount of information that is available on or through it; • The dynamic nature of the information
Ngày tải lên: 08/10/2012, 15:22
current situation of outsourcing development, a number of favorable factors promoting this industry as well as analysis of outsourcing activities FPT Software.doc
... OutsourcingKyu : Japanese levels of proficiency or experienceNASDAQ : National Association of Securities Dealers Automated QuotationSystemNASSCOM : National Association of Software and Services CompaniesNTT ... legacy that has created a greater awareness ofFrench and English than many East Asian rivals Young Vietnamese with betterEnglish communication have already overcome the language barrier that wasbelieved ... between Pakistan and India, and the SriLankan military’s struggles against the Liberation tigers of Tamil Elam, butfortunately these chaos and upheaval do not happen in Vietnam In fact, Vietnam isa
Ngày tải lên: 27/10/2012, 16:41
Tài liệu Báo cáo khoa học: Production of biologically active forms of recombinant hepcidin, the iron-regulatory hormone docx
... GAGGAGAAGCCCGGTTATGTTTTGCAACAGATACCACACTGGGAATT GTTACAGCATTTACAGCAGAAGATGCAGATGGGGAAGTTGGTGTCCA GACGACGACAAGATGGACACCCACTTCCCGATCTGCATTTTCTGCTG CGGCTGCTGTCATCGATCAAAGTGTGGGATGTGCTGCAAGACGTAA GAGGAGAAGCCCGGTTACGTCTTGCAGCACATCCCACACTTTGATCG ... and (c) S-huhepc enterokinase digestion to generate huhepc For GACGACGACAAGATGGACACCAACTTCCCCATCTGCATCTTCTGCTG TAAATGCTGTAACAATTCCCAGTGTGGTATCTGTTGCAAAACATAA GAGGAGAAGCCCGGTTATGTTTTGCAACAGATACCACACTGGGAATT ... GAGGAGAAGCCCGGTTACGTCTTGCAGCACATCCCACACTTTGATCG ATGACAGCAGCCGCAGCAGAAAATGCAGATCGGGAAGTGGGTGTCCA MDTNFPICIFCCKCCNNSQCGICCKT MDTHFPICIFCCGCCHRSKCGMCCKT GSGMETAAKPERQHMDSPDLGTDDDDKMDTNFPICIFCCKCCNNSQCGICCKT GSGMETAAKPERQHMDSPDLGTDDDDKMDTHFPICIFCCGCCHRSKCGMCCKT...
Ngày tải lên: 18/02/2014, 18:20
good eats, a treasury of favorite recipes
... potato per person THE BAKED POTATO BANANA SPLITSVILLE Basic Caramel Software: cups sugar cup water tablespoon light corn syrup Caramel Sauce Software: batch caramel cups heavy cream Banana Brulee ... Brulee Software: bananas Sugar for coating Additional Splitsville Software: Ice cream of your choice Hardware: Small, heavy saucepan Clean soup spoon Candy thermometer Parchment paper sheet pans ... COFFEE: BLACK, NO CHASER 19 Good Eats! A Treasury Of Favorite Recipes When purchasing a coffee maker (either manual or electric), look for a model that brews into a thermal carafe rather than...
Ngày tải lên: 03/05/2014, 10:27
a treasury of sanskrit poetry
... From Subhashila Ratnakosha 87 The Traveller at the Well 110 88 Forest Fire 111 xvi A Treasury of Sanskrit Poetry D1VAKARA From Surngadhara Paddhati 89 The Spread of Fame 12 AMARU Amarusataka 90 Love ... KSHEMIsv ARA Chandakausika 143 The Sacrificial Tree 150 SIDDHA Upamitibhavaprapancha Kathii 144 The Beggar Unmeritorious 15 ANANTA From Siirngadhara Paddhati 145 The Poet's Fame 152 KALASAKA From ... Chhiindogya 20 Upanishad You are That 21 Taittiriya Upanishad 21 Learn and Teach Munqaka 22 21 Upanishad Two Birds 22 VYASA Mahiibhiirata 23 The Humiliation of Draupadi 23 24 Death of Abhimanyu 28...
Ngày tải lên: 04/05/2014, 15:35
Application of biologically active micelles in drug delivery across the blood brain barrier
... administration of LPS in mice, so the neuroprotection can be achieved with nigral administration of an anti-IL-1ȕ neutralizing antibody (Arai et al., 2004; Arai et al., 2006) There are many anti-inflammatory ... eliminate them They have been administrated for several decades, and are capable of sterilizing the cerebral spinal fluid (CSF) in a relatively rapid and reliable way Antibiotics that are effective ... Ciprofloxacin and Penicillin are two typical broad-spectrum antibiotics commonly used Ciprofloxacin is mainly against Gram-negative bacteria and Penicillin is usually against Gram-positive bacteria...
Ngày tải lên: 11/09/2015, 09:10
The roles of biologically active gasotransmitters (NO and h2s) in myocardial ischemia reperfusion
... Yilong Jan 25th, 2008 ii LIST OF ABBREVIATIONS AAR Area at Risk AMI Acute Myocardial Infarction ASA Acetylsalicylic acid (aspirin) BCA β-cyano-L-alanine BH4 Tetrahydrobiopterin BW Body Weight CABS ... ester linkage The chemical structures of NOParacetamol and paracetamol are listed in Figure 1.4 Paracetamol NO-Paracetamol Figure 1.4 Chemical structures of paracetamol NO-Paracetamol Compared with ... Rat 91 3.3.1 Effects of paracetamol and NO-Paracetamol on systemic BP and HR 91 3.3.2 Effects of paracetamol and NO-Paracetamol on infarct size 94 3.3.3 Effects of paracetamol and NO-Paracetamol...
Ngày tải lên: 11/09/2015, 16:07
Tài liệu Báo cáo khoa học: Physico-chemical characterization and synthesis of neuronally active a-conotoxins docx
... Mass Methods Reference v v v m m m v v v p m m m a7 N /A a7 a3 /b4 (less active) (less active) a3 /b2, a7 a3 /b2, a7 a3 /b2, a7 a3 b2; a6 b2b3 a3 b2 /a3 b4; a7 a3 a7b4 /a3 a5b4 a3 b2 a a7 a a7 a a3b2 a3 b2 a6 b2b3 ... characterization of native a- conotoxins Analysis of neuronally active a- conotoxins using HPLC and MS, including identification of post-translational modifications Isolation and identification Standard ... example, asparagine to aspartic acid, or glutamine to glutamic acid changes [14] The a- conotoxins EpI, PnIA, GIC, GID, AnIA and AnIB contain pairs of asparagine residues [5,10,21,23,24] (Table...
Ngày tải lên: 19/02/2014, 12:20