a selectivity bias pp 1119 1143
HAI BÀI TOÁN HÓA A 2009 VỚI PP ION-ELECTRON
... 0,12 0,24 2+ Cu Cu +2e 0,03 0,3-0,24=0,06 mCu= 0,03 x 64 = 1,92gam ...
Ngày tải lên: 02/09/2013, 01:10
Chương 3 Các PP tích P.A đầu tư PP giá trị tương đương pdf
... chu i A Tiêu chu n hi u qu c a phương án: Max AW PA có l i nh t Các PA có thu nh p: Min AWC t t nh t Lưu ý: Phương pháp AW không c n xét TKPT chung Ch c n so sánh tr c ti p AW gi a PA PP GIÁ ... CHÍNH PP GIÁ TR HÀNG NĂM (AW) Giá tr hàng năm (Annual Worth) Quy F i% P chu i A i t t c dòng ti n TKPT 10 12 N AW PP GIÁ TR HÀNG NĂM (AW) Giá tr hàng năm (Annual Worth) Quy F i% P PW chu i A i ... MARR (%) Máy ti n A 8% Th i kỳ phân tích = 10 năm (BSCNN c a 10) Máy A ph i thay m i l n Ví d minh ho Giá tr AW th i chu kỳ ho t ng c a PA u gi ng Ch c n tính AW cho m t chu kỳ ho t ng c a PA...
Ngày tải lên: 25/03/2014, 12:20
Báo cáo y học: " Methodological challenges in following up patients of a hospital child protection team: is there a recruitment bias" pptx
... Zurich Special thanks go to Martina Hug, Michael Inauen, Sabine Keller, Rabia Liamlahi, Georg Staubli, Daniel Suter, and Alexandra Tatalias Authors’ contributions All authors participated equally in ... collected at the initial referral to the CPT were used to analyze characteristics of non-participation, as these data were available for both participants and nonparticipants Demographic data were available ... Perpetrators were categorized as intrafamilial or extrafamilial To account for a possible informant bias, it was coded whether the primary contact for participants and contactable non-participants...
Ngày tải lên: 13/08/2014, 18:21
Unit 13 A 1 - 2 pp
... 13: ACTIVITIES AND THE SEASONS Period: 79 Section A: The weather and seasons [A1 -2] I Vocabulary: II Grammar: What’s the weather like in the summer ? It’s hot III Practice: Listen and repeat: ... warm in the spring It is cool in the fall Thursday, March 11th, 2013 Unit 13: ACTIVITIES AND THE SEASONS Period: 79 I Vocabulary: II Grammar: Section A: The weather and seasons [A1 -2] III Practice: ... Thích Thursday, March 11th, 2013 Unit 13: ACTIVITIES AND THE SEASONS Period: 79 Section A: The weather and seasons [A1 -2] I Vocabulary: (n): M a xuân - Summer (n): M a hè - Autumn M a thu (n):...
Ngày tải lên: 25/01/2015, 14:00
Đ.A BAI TAP PP TOA DO TRONG MP
... tớch tam giỏc ABC bng v im A cú honh dng HD: A d1 A (a; a ) (a> 0) Pt AC qua A d1 : x y 4a = AC d2 = C( 2a; 3a ) a a Pt AB qua A d2 : x + y + 2a = , AB d2 = B ; ữữ S ABC = BA.BC ... kớnh AC, gii h B,D Bi 10: Gi n = (a; b) l VTPT ca AB -AB qua M nờn pt AB cú dng a( x 1) + b(y 1) = -AD i qua N v AB nờn pt AD cú dng b(x-2) ay = Vỡ AB = 2AD nờn d(O,AD) = 2d(O,AB) Gii v chn a ... hỡnh vuụng ABCD bit A thuc d, C thuc d v B, D thuc Ox Hng dn gii bi PP ta mt phng GV: Nguyn Hu Trung -V hỡnh - A d A( a ;a) C (a; -a) (Vỡ C x vi A qua BD hay Ox) C d 2a a = a = A( 1; 1) v...
Ngày tải lên: 14/11/2015, 16:03
Báo cáo khoa học: "Veterinary decision making in relation to metritis - a qualitative approach to understand the background for variation and bias in veterinary medical records"
... create meaningful data valid in large scale analyses (across herds and veterinary practices) Such veterinarians would generally want to focus on possibilities for across-herd data analyses and, ... following situations in a herd (e.g scoring a cow and initiating a metritis treatment), would you please elaborate on that specific situation?' Data Analysis The qualitative analysis is based on a phenomenographic ... Acta Veterinaria Scandinavica 2009, 51:36 Background Files with information on animal disease have a variety of applications at both the herd and national level, including...
Ngày tải lên: 25/10/2012, 10:45
pp giai nhanh de khoi A&B- 2009
... gồm ba muối (khơng có đồng phân hình học) Cơng thức ba muối là: A CH2=CH-COONa, CH3-CH2-COONa HCOONa B HCOONa, CH≡C-COONa CH3-CH2-COONa C CH2=CH-COONa, HCOONa CH≡C-COONa D CH3-COONa, HCOONa CH3-CH=CH-COONa ... liên hệ m, a V là: A m = 2a − V 22, V V V C m = a + D m = a − 11, 5, 5, V 2 .a a V V m = mC + mH + mO = 12 + + 16.( − ) = a 22, 18 18 22, 5, B m = 2a − Câu 21 Cho 3,68 gam hỗn hợp gồm Al Zn tác ... 50% Khối lượng anilin thu điều chế từ 156 gam benzen A 186,0 gam B 55,8 gam C 93,0 gam D 111,6 gam m = 156.93.0,3 : 78 = 55,8 Câu 59 H a tan hồn tồn 1,23 gam hỗn hợp X gồm Cu Al vào dd HNO đặc,...
Ngày tải lên: 04/09/2013, 18:10
Bài soạn giao an pp hinh dong _Giao vien Trần Minh Lâm _trường Tân Thiêng A
Ngày tải lên: 28/11/2013, 14:11
Báo cáo khoa học: a-Conotoxin analogs with additional positive charge show increased selectivity towards Torpedo californicaand some neuronal subtypes of nicotinic acetylcholine receptors pdf
... of the available X-ray data Experimental procedures Table Amino acid interactions between nAChR (a c interface) and bound a- conotoxins SIA, [D12S]SIA and [D12K]SIA The additional interactions ... digitized and sampled online on a Pentium PC via a home-made operational amplifier supplying a virtual ground and a Digidata1200 B interface (Axon Instruments Inc., Foster City, CA) Acquisition and analysis ... starting [A1 0L]PnIA for chicken a7 nAChR and L stagnalis AChBP [19] X-Ray data on the AChBP )a- conotoxin complex were the basis for constructing a model for a7 nAChR complexes with [A1 0L]PnIA and...
Ngày tải lên: 16/03/2014, 13:20
Báo cáo khoa học: "The Benefit of Stochastic PP Attachment to a Rule-Based Parser" doc
... in fact systematically overestimated We therefore adopted his approach and artificially inflated all noun+preposition counts by a constant factor i To estimate an appropriate value for this factor, ... no additional advantage In any case, the exact figure depends closely on the valuation of the existing constraints of the grammar and is of little importance as such 227 Label PP ADV OBJA APP ... Head-Driven Statistical Models for Natural Language Parsing Phd thesis, University of Pennsylvania, Philadephia, PA A Dubey 2005 What to when lexicalization fails: parsing German with suffix analysis...
Ngày tải lên: 17/03/2014, 04:20
Báo cáo Y học: Substrate selectivity and sensitivity to inhibition by FK506 and cyclosporin A of calcineurin heterodimers composed of the a or b catalytic subunit potx
... confirm that CnAa and CnAb proteins are expressed by the appropriate recombinant CnAa and CnAb baculoviruses (Fig 1B,C) Kinetic assays of CaNa and CaNb phosphatase activity Fig SDS/PAGE and Western ... serum was purchased from Atlanta Biologicals CaM–Sepharose was purchased from Amersham Pharmacia Antibiotics, FKBP12, and pNPP were obtained from Sigma Cyclophilin A, cyclosporine A, and FK506 ... shown are the averages ± SD from three assays in triplicate for each CaN heterodimer CaNa, d; CaNb, s CaM dissociation constants for both CaNa and CaNb Fast and slow rates of s)1 and 0.4 s)1, and...
Ngày tải lên: 24/03/2014, 03:21
Báo cáo khoa học: Identification of the N-terminal region of TjZNT2, a Zrt⁄Irt-like protein family metal transporter, as a novel functional region involved in metal ion selectivity ppt
... -MASSPTKILCDAGESDLCRDDAAAFLLKFVAIASIL 1:MFFIDVLWKLFPLYLFGSERDYLSETESILKIVPETMAAASSLSILCDAGEPDLCRDDSAAFLLKLVAIASIF TjZNT1 TjZNT2 37:LAGVAGVAIPLIGKNRRFLQTEGNLFVAAKAFAAGVILATGFVHMLAGGTEALTNPCLPDYPWSKFPFPGFFA ... Thlaspi caerulescens as a model system Ann Bot 102, 3–13 Weber M, Harada E, Vess C, Roepenack-Lahaye E & Clemens S (2004) Comparative microarray analysis of Arabidopsis thaliana and Arabidopsis halleri ... transport FEBS Lett 581, 2263–2272 N-terminus of TjZNT2 is involved in ion selectivity Tomatsu H, Takano J, Takahashi H, Watanabe-Takahashi A, Shibagaki N & Fujiwara T (2007) An Arabidopsis thaliana...
Ngày tải lên: 29/03/2014, 00:20
báo cáo hóa học: " Bayesian bias adjustments of the lung cancer SMR in a cohort of German carbon black production workers" pdf
... Bayesian analyses can be used - but Bayesian analyses appear to come with the stronger rationale because the only formal statistical interpretation available for Monte Carlo simulation approaches ... uncertainty about the parameters after we have analyzed the observed data The goal of the analysis is to calculate how we should bet about the parameters after the data was observed and analyzed ... epidemiology was written by Greenland and Lash (chapter 19 of [9]) An application of Bayesian techniques in bias adjustment via data augmentation and missing data methods was explained and exercised...
Ngày tải lên: 20/06/2014, 00:20
Báo cáo hóa học: " Experimental observations of rapid Maize streak virus evolution reveal a strand-specific nucleotide substitution bias" potx
... days and involving tens of leafhoppers Our second approach, used with MSV-Tas, was to avoid serial leafhopper transmissions altogether To achieve this, a single sugarcane plant (cultivar Uba) was ... increased C and G deamination rates As deamination rates are probably higher for ssDNA, this was taken to imply that high begomovirus mutation rates might be at least partially attributable to the ... evolution rates of ssDNA and dsDNA viruses, proof of this may ultimately require a detailed comparative analysis of the individual impacts of all mutagenic reactions and repair pathways acting on...
Ngày tải lên: 20/06/2014, 01:20
báo cáo hóa học:" Reference bias: presentation of extreme health states prior to eq-vas improves health-related quality of life scores. a randomised cross-over trial" doc
... the final follow-up assessment (VAS 3) Data Analysis Demographic and baseline EQ-VAS data were tabulated (Table 1) Raw data was checked for normality graphically and using tests for skew and kurtosis[42,43] ... EQ-VAS includes a 100 point visual analogue rating scale with a bottom anchor of ‘worst imaginable health’ and a top anchor of ‘best imaginable health’[18] The EQ-VAS has favourable empirical ... consideration of subjective patient reported outcomes may cause a patient to paradoxically report a change when no change has occurred, or a disproportionate change than that which has actually taken...
Ngày tải lên: 20/06/2014, 15:20
Phiếu đánh giá KHBH áp dụng pp học theo dự án
... phương tiện Chia sẻ, thảo luận cỏc thụng tin l a chọn cỏch thức trỡnh bày Tich cực tham gia trỡnh bày kết nghiờn cứu, cỏch trỡnh bày mạch lạc, nờu bõt trọng tâm; hỡnh thức trỡnh bày a dạng Phõn ... thực đ a ) • Có thể sử dụng nhiều phương pháp (đọc tài liệu, truy cập internet, quan sát, vấn) d Xử lý thông tin • L a chọn thông tin tập trung vào trọng tâm vấn đề nghiên cứu • Giải vấn đề d a thông ... cho thành viên (ai ? Làm gỡ ?) + Đề xuất thời gian dự kiến sản phẩm cho nhiệm vụ/ * B¾t ®Çu b»ng ®éng tõ 1,5 Điểm đánh giá Nhận xột • • • 2.3 hoạt động Sử dụng phù hợp, hiệu quả, a dạng nguồn thông...
Ngày tải lên: 03/07/2014, 17:00
Giáo án Tin a- Thiết lập Hiệu ứng PP
... chuột - Automatically after: Thực chuyển tiếp sau khoảng thời gian - Apply to All Slides: áp dụng cho tất slide CÁC HIỆU ỨNG CHO ĐỐI TƯNG TRÊN SLIDE - Entrance: tạo đối tượng xuất - Emphasis: Nhấn ... tượng sau xuất - Exit: đối tượng khỏi slide sau thực xong hiệu ứng - Motion Path: tạo đường chuyển động cho đối tượng CÁC HIỆU ỨNG CHO ĐỐI TƯNG TRÊN SLIDE Slide Show\ Custom Animation… a Thêm ... thẻ Add Effect B3 Chọn dạng hiệu ứng thích hợp B4 Chọn tùy chọn Start: bắt đầu thực hiệu ứng On click: nháy chuột With previous: với trước After previous: sau trước khoảng thời gian ...
Ngày tải lên: 18/07/2014, 12:00
B NG KÊ T A Đ GÓC RANH Đ T CŨ T A Đ VN2000 ĐI M A B C D E X(m) 1143736.146 1143673.179 pps
... LOGIA GI T PHƠ I 3085 W 4a W1 0a AY11 LOGIA LOGIA W 4a LOGIA W 4a W5b LOGIA LOGIA AY12 GI T PHƠ I 1215 W5b 7000 W 4a 7000 W1 0a W1 0a KT-3-04 CÔNG TRÌNH - PROJECT 47000 CAO AX2 AX3 AX4 AX5 AX6 AX7 AX8 ... OSC LAND TÊN B N V - DRAWING TITLE AX1 AX2 E KT-3-05 AX3 AX4 AX5 AX6 AX7 M T B NG H M AX8 T L SCALE S B NV DRAWING No : 150 T NG S B N V DWG.TOTAL 110-2010/ KT-1-03 142 AX1 AX2 AX3 AX4 AX5 E ... W1 0a 2400 AY11 W1 0a -0.150 W 4a 4360 315 315 3085 W 4a W5b 1005 W 4a B N HOA GI T PHƠ I AY12 1799 GI T PHƠ I 1800 S NH W5b 47000 CÔNG TRÌNH - PROJECT AX2 AX3 AX4 AX5 AX6 AX7 AX8 CAO C CĂN H OSC LAND...
Ngày tải lên: 23/07/2014, 19:20