a moral dilemma posed by medical technology

báo cáo khoa học: " Evaluation of herbal cannabis characteristics by medical users: a randomized trial" pps

báo cáo khoa học: " Evaluation of herbal cannabis characteristics by medical users: a randomized trial" pps

... speakers fees, honoraria and grant support from companies developing cannabinoid products (AstraZeneca, Bayer, Cannasat, GW Pharma, Solvay and Valeant) Conclusion We have shown that medical cannabis ... users obtaining herbal cannabis from Health Canada (data to Sept 2006)10 Percentage of authorized users obtaining herbal cannabis from Health Canada (data to Sept 2006)10 herbal material should ... of Cannabis Medical Access, Health Canada The study was funded through a research contract agreement between the MUHC Research Institute and Health Canada We are grateful to Suzanne Desjardins...

Ngày tải lên: 11/08/2014, 20:20

6 339 0
Enhancement of domestic wastewater treatment under long sewer line condition in a laboratory set-up by Aspergillus niger bioaugmentation

Enhancement of domestic wastewater treatment under long sewer line condition in a laboratory set-up by Aspergillus niger bioaugmentation

... phosphatase (alkaline, acid and phosphohydrolase), cellulase (α-glucosidase, β-galactosidase, α-mannosidase), esterase (C4 and lipase C8) and protease (leucine aminopeptidase) The enzymatic activities ... α-fructosidase α-mannosidase glucosaminidase β-glucosidase α-glucosidase β-galactosidase β-glucurosidase α-galactosidase Phosphohydrolase Acid phosphatase Chemotrypsine Trypsine Cystine aminopeptidase ... reactor was then inoculated with biomass prepared as indicated The sampling period determination has been described in previous research (Coulibaly et al., 2002) Wastewater Wastewater was taken...

Ngày tải lên: 05/09/2013, 09:08

7 609 0
Tài liệu Creating a Logical Standby Database by Using Enterprise Manager ppt

Tài liệu Creating a Logical Standby Database by Using Enterprise Manager ppt

... Logical Standby Database • Configure the database guard to control user access to tables • ALTER DATABASE GUARD command keywords: – ALL: prevents users from making changes to any data in the database ... the database – STANDBY: prevents users from making changes to any data maintained by Data Guard SQL Apply – NONE: normal security • Query GUARD_STATUS column in V$DATABASE • Database guard level ... After completing this lesson, you should be able to the following: • Explain the advantages of SQL Apply • Explain when to use a logical standby database • Create a logical standby database by...

Ngày tải lên: 09/12/2013, 16:15

29 497 0
Challenges faced by information technology students in reading english for computer science

Challenges faced by information technology students in reading english for computer science

... reconstructs, as best as he can, a message which has been encoded by a writer as a graphic display” William (1984) had the same view on reading, especially on the act of reconstructions as Goodman He argues ... simple as an 'approach' to teaching, or what Dudley-Evans describes as an 'attitude of mind' II.2.2 Challenges in ESP Reading II.2.2.1 Language challenges Language plays a vital role in reading ... caused by the imperfect knowledge of the target language and the interference of the native language Clarke(1980) and Alderson(1984) also share the same idea They both agreed that a lack of appropriate...

Ngày tải lên: 18/12/2013, 15:37

43 771 1
Google adwords-  a brave new world by andrew goodman

Google adwords- a brave new world by andrew goodman

... pages had quality as far as AdWords was concerned, let alone that their lack of quality could be a factor in anything!” If “landing page quality” were a factor in ad rankings, wouldn’t that make ... up all the gaps, and you have an overall performance gap Closing that gap is the goal It takes time and effort Again, to be clear: on every significant component of an account, there is an imaginary ... example of an AdWords hedgehog than Ray Allen of AmericanMeadows.com I worked with him in his earliest days of AdWords experimentation and watched as he became a featured Google case study, and...

Ngày tải lên: 31/12/2013, 21:40

44 506 0
Tài liệu Crafting a Rule of Life by Stephen A macchia docx

Tài liệu Crafting a Rule of Life by Stephen A macchia docx

... understanding and engaging what nonviolence is all about.” Nonviolence as a way to pursue justice and reconciliation is, for Sami, a source of transformation and healing Sami Awad has dedicated ... Alexia Salvatierra, Daniel Hill, Efrem Smith, Larry Martin, Mark Labberton and Gary Burge (United States) Each chapter also includes a section on contemporary praxis (reflection paired with action) ... up in a Christian evangelical family and had a personal experience accepting Christ as my Savior as a young child, it was not until very recently that I was able to fully understand how faith...

Ngày tải lên: 14/02/2014, 07:20

32 389 0
Tài liệu HealthDoc: Customizing patient information and health education by medical condition and personal characteristics pptx

Tài liệu HealthDoc: Customizing patient information and health education by medical condition and personal characteristics pptx

... “Introduction.” In Blackboard architectures and applications, edited by V Jagannathan, Rajendra Dodhiawala, and Lawrence S Baum, (Perspectives in artificial intelligence, volume 3), Boston: Academic Press, ... selected by matching each sentence against a pattern-list of items, each of which can be the spelling of a word, a lexical item, a syntactic category, a grammatical function, a semantic category ... We regard this use of a master document as a new approach to natural language generation, in which generation from scratch is avoided; ‘generation by selection and repair’ uses a partially specified,...

Ngày tải lên: 14/02/2014, 13:20

14 422 0
Tài liệu Báo cáo khoa học: Expression and secretion of interleukin-1b, tumour necrosis factor-a and interleukin-10 by hypoxia- and serum-deprivation-stimulated mesenchymal stem cells Implications for their paracrine roles ppt

Tài liệu Báo cáo khoa học: Expression and secretion of interleukin-1b, tumour necrosis factor-a and interleukin-10 by hypoxia- and serum-deprivation-stimulated mesenchymal stem cells Implications for their paracrine roles ppt

... TCCTGGCAATCGTGGTT CAA and ACCAGCTGGGCCAACATTTC; collagen III: TGGACAGATGCTGGTGCTGAG and GAAGGCCAG 3696 CTGTACATCAAGGA; alpha smooth muscle actin (a- SMA): AGCCAGTCGCCATCAGGAAC and CCGG AGCCATTGTCACACAC; ... 5¢-GCTGTGGCAGCTACCTATGTCTTG-3¢ and 5¢-AGGTCGTCATCATCCCACGAG-3¢; TNF -a: 5¢-AACTCGAGTGACAAGCCCGTAG-3¢ and 5¢-GTAC CACCAGTTGGTTGTCTTTGA-3¢; IL-10: 5¢-CAGACCC ACATGCTCCGAGA-3¢ and 5¢-CAAGGCTTGGCAA CCCAAGTA-3¢; collagen I: ... Elnekave E, Mentink-Kane MM, Hodges MG, Pesce JT, Ramalingam TR, Thompson RW, Kamanaka M, Flavell RA, Keane-Myers A et al (2007) IL-13Ralpha2 and IL-10 coordinately suppress airway inflammation, airway-hyperreactivity,...

Ngày tải lên: 18/02/2014, 04:20

11 653 0
Tài liệu Báo cáo khoa học: The alr2505 (osiS) gene from Anabaena sp. strain PCC7120 encodes a cysteine desulfurase induced by oxidative stress docx

Tài liệu Báo cáo khoa học: The alr2505 (osiS) gene from Anabaena sp. strain PCC7120 encodes a cysteine desulfurase induced by oxidative stress docx

... GTG ACA CGG GTA AGC GCC TTG GCA AGG TCT GCC GTT ACA CAC GAA GGC CAG AAT CGT GTT TGT GTT GGT AAC ATT CAA ATT GTT TAC CTC CGT CTC ACC ATT GGG TTC ATG TTT TTA GC CTC T TC TA A TAC GGT CAA GAT GC TA ... activity was quantified by determining the amount of alanine formed from l-cysteine 3722 alr2505 AGG GGT GCC CCT AAA CCC GTT TTC AAT GCC GTT CAA GAG TTA CGC GAG ACG AAT TTA TCT ATC TTG GCA GCA AGA CCG ... desulfurase as well as cystine lyase activity Biochem Biophys Res Commun 320, 571–577 Kaneko T, Nakamura Y, Wolk CP, Kuritz T, Sasamoto S, Watanabe A, Iriguchi M, Ishikawa A, Kawashima K, Kimura T...

Ngày tải lên: 18/02/2014, 04:20

11 728 0
Tài liệu Báo cáo khoa học: Proteolysis of Pseudomonas exotoxin A within hepatic endosomes by cathepsins B and D produces fragments displaying in vitro ADP-ribosylating and apoptotic effects doc

Tài liệu Báo cáo khoa học: Proteolysis of Pseudomonas exotoxin A within hepatic endosomes by cathepsins B and D produces fragments displaying in vitro ADP-ribosylating and apoptotic effects doc

... of appearance of ETA in hepatic plasma membranes and endosomes after toxin administration Rat hepatic plasma membrane (A) and endosomal fractions (B) were isolated at the indicated times after ... WSEWASGKVLCLLDPLDGVYNYLAQQRCNLDDTWEGKIYRVLAGNPAKHDLDIKPTVISHRL HFPEGGSLAALTAHQACHLPLETFTRHRQPR279 280 ETA -A GWEQLEQCGYPVQRLVALYLAARLSWNQVDQV IRNALASPGSGGDLGEAIREQPEQARLALTLAAAESERFVRQGTGNDEAGAANADVVSLTCP ... UÆmL)1) and human plasma a2 MG were purchased from Sigma Rabbit antibody against Pseudomonas ETA was purchased from Sigma Western blot analysis using the antibody against ETA revealed a strong affinity...

Ngày tải lên: 18/02/2014, 04:20

15 588 0
Tài liệu A Lie Never Justifiable By H. Clay Trumbull doc

Tài liệu A Lie Never Justifiable By H. Clay Trumbull doc

... –Samuel at Bethlehem – Micaiah before Jehoshaphat and Ahab –Character and Conduct – Abraham –Isaac –Jacob –David –Ananias and Sapphira –Bible Injunctions and Warnings IV DEFINITIONS Importance ... Standards and Practices of Primitive Peoples –Sayings and Doings of Hindoos –Teachings of the Mahabharata –Harischandra and Viswamitra, the Job and Satan of Hindoo Passion-Play – Scandinavian ... would be quite as fair to claim that God approved of Rahab’s harlotry, in this case, as to claim that he approved of her lying Rahab was a harlot and a liar, and she was ready to practice in both...

Ngày tải lên: 19/02/2014, 09:20

110 261 0
Tài liệu Potterism, A Tragi-Farcical Tract by Rose Macaulay ppt

Tài liệu Potterism, A Tragi-Farcical Tract by Rose Macaulay ppt

... that we came to the conclusion nearly always that the 40 Potterism, A Tragi-Farcical Tract majority were wrong The fact is that majorities nearly always are The heart of the people may be usually ... the stunt among a certain section, so it was probably as inaccurate as popular sayings usually are; as inaccurate as the picture drawn by another section—the Potter press section—of an army going ... cynical face, a first in Natural Science, and a chemical research fellowship In those happy days it was easy to stay in places, even by the sea, and they stayed first at the fishing village of...

Ngày tải lên: 19/02/2014, 16:20

200 357 0
Tài liệu Reaching All Students - A Resource for Teaching in Science, Technology, Engineering & Mathematics pdf

Tài liệu Reaching All Students - A Resource for Teaching in Science, Technology, Engineering & Mathematics pdf

... Choosing and Using Instructional Materials11 Advantages and Disadvantages of Using Textbooks Books are a highly portable form of information and can be accessed when, where, and at whatever rate and ... and many individuals want to be identified not by a continent but by the nationality of their ancestors, for example, ―Thai American‖ or ―Japanese American.‖ In California, ―Pacific Islander‖ and ... Students may have religious holidays and practices that require accommodations at certain times during the academic calendar year Students with disabilities may also require special accommodations...

Ngày tải lên: 21/02/2014, 09:20

229 374 1
Tài liệu Title: Elizabethan England From ''''A Description of England,'''' by William Harrison pptx

Tài liệu Title: Elizabethan England From ''''A Description of England,'''' by William Harrison pptx

... I may die at either place My goods to be divided into equal parts 'of which one parte and an halfe shall remaine vnto Marion Harrison alias Marion Isebrande and the daughter of William Isebrande ... parishioners that remain must answer and bear them out: for they plead more charge other ways, saying: "I am charged already with a light horse; I am to answer in this sort, and after that matter." And ... merely a matter of political arrangement Race after race have swept over the island home and left lasting impression upon the soil England is not a matter of bounds and barriers; it is a human fabric...

Ngày tải lên: 21/02/2014, 21:20

193 462 0
Tài liệu English Listening Courses: A Case of Pedagogy Lagging behind Technology docx

Tài liệu English Listening Courses: A Case of Pedagogy Lagging behind Technology docx

... language teachers play a part in making this happen sooner?" Language teachers are known for having heavy teaching and marking loads and therefore too busy to take up any extra work, although creative ... as a goal in itself rather than as a means to an end It seems that Cauldwell’s assumption is that citation forms are easy to learn or identify, although in reality that is not always the case ... 4) Language teachers, particularly on their way to a listening class, are often seen carrying more than a handful of teaching materials and student copies, and a cassette player When course audio...

Ngày tải lên: 24/02/2014, 18:20

19 503 0
A Diversity Of Creatures By Rudyard Kiping pdf

A Diversity Of Creatures By Rudyard Kiping pdf

... cried, and fell across our knees.    ‘Glass  of  water,  please,ʹ  said  Takahira  to  a helmeted  shape  that  leaped forward. ‘He is a little faint.ʹ    The lights switched off, and the darkness stunned like an avalanche.  ... fifty‐foot spruce and tamarack, grown in five years. The population  was  close  on  two  millions,  largely  migratory  between  Florida  and  California,  with  a backbone  of  small  farms  (they  call  a ... into  a shaller,  an’  it  rolled  a piece,  an’ a great old stiff man‘s arm nigh hit me in the face. Then we was  sure. ”‘Tis a man,” ses Jim. But the face was all a mask. “I reckon it‘s  Mary‘s Lunnon father,” he ses presently. “Lend me a match and I‘ll ...

Ngày tải lên: 06/03/2014, 07:20

324 241 0
Báo cáo khoa học: A ribonuclease zymogen activated by the NS3 protease of the hepatitis C virus potx

Báo cáo khoa học: A ribonuclease zymogen activated by the NS3 protease of the hepatitis C virus potx

... are listed in Table Both unactivated and activated 1C 5460 Fig Conformation and conformational stability of unactivated (d) and activated (s) 1C zymogens assessed by CD (A) Near-UV CD spectra ... the catalytic activity, as both its kcat and Km values remain lower than those of activated 1C zymogen The ratio of the (kcat Km)activated value to the (kcat Km)unactivated value provides an ... ribonucleolytic activity and RI afnity of unactivated and activated 1C zymogen with those of other RNase A variants, we can estimate the therapeutic potential of an HCV RNase A zymogen Unactivated 1C...

Ngày tải lên: 07/03/2014, 11:20

9 392 0
Báo cáo khoa học: Glycoprotein Ib-mediated platelet activation A signalling pathway triggered by thrombin doc

Báo cáo khoa học: Glycoprotein Ib-mediated platelet activation A signalling pathway triggered by thrombin doc

... PY20 (Santa Cruz Biotechnology Inc., Santa Cruz, CA, USA) and antiGPIb mAb SZ2 (Immunotech, Marseille, France) were purchased as indicated The anti-GPIb mAb Bx-1 directed against the macroglycopeptide ... kDa, and the appearance of one band at 40 kDa These results indicate that most of the protein tyrosine phosphorylations take place downstream of PI3-kinases, Src family kinases and PKC activation, ... thrombin and upstream of aIIbb3 activation GPIb plays an important role in platelet activation by low thrombin concentrations and therefore at the start of the haemostasis process when trace amounts...

Ngày tải lên: 08/03/2014, 02:21

12 257 0
A FOREIGN EXCHANGE PRIMER By FRANKLIN ESCHER doc

A FOREIGN EXCHANGE PRIMER By FRANKLIN ESCHER doc

... bankers' demand against remittances of long bills, it appears that the successive steps in an actual transaction are about as follows: The banker in New York having ascertained by cable the rate ... such a privilege, and the only way he can get actual possession of the goods is to actually pay the draft under a rebate-of-interest arrangement All bills drawn on banks are naturally "acceptance" ... afterward There used to be a saying among exchange dealers that cotton exports make exchange faster than anything, but nowadays bond sales abroad have come to take first place For foreign participation...

Ngày tải lên: 15/03/2014, 00:20

90 213 0
Báo cáo khoa học: Crystal structure of a glycoside hydrolase family 6 enzyme, CcCel6C, a cellulase constitutively produced by Coprinopsis cinerea pot

Báo cáo khoa học: Crystal structure of a glycoside hydrolase family 6 enzyme, CcCel6C, a cellulase constitutively produced by Coprinopsis cinerea pot

... et al crystal structure of a cellulase was reported; it was a catalytic domain of Hypocrea jecorina Cel 6A (HjeCel 6A, formerly designated cellobiohydrolase II), a GH6 cellobiohydrolase from an ascomycete ... residues and could act as a proton donor and a base, respectively Another aspartic acid residue (Asp175 of HjeCel 6A) has been proposed to contribute to the electrostatic stabilization of the partial ... program arp ⁄ warp [37] The refinement was carried out using the program refmac in the ccp4 suite, and anisotropic refinement was applied for data bet˚ ter than 1.2 A resolution Manual adjustment and...

Ngày tải lên: 15/03/2014, 10:20

11 489 0
w