a crystal structure of fe l4 2 pf6 2 ch3cn
Tài liệu Báo cáo khoa học: ˚ The 1.8 A crystal structure of a proteinase K-like enzyme from a psychrotroph Serratia species docx
... program for molecular replacement J Appl Crystallogr 30, 1 022 –1 025 Perrakis A, Harkiolaki M, Wilson KS & Lamzin VS (20 01) ARP ⁄ wARP and molecular replacement Acta Crystallogr Sect D Biol Crystallogr ... also has an aspartic acid residue at position at 20 0, and with the same conformation as in the two other structures, but Asp200 forms a salt bridge to Lys253 (Ala253 and Asn250 in PRK and VPRK, ... methoxysuccinyl-Ala-Ala-Pro-Ala-chloro˚ methyl ketone: an x-ray study at 2. 2 -A resolution J Biol Chem 26 6, 17695–17699 FEBS Journal 27 3 (20 06) 61–71 ª 20 05 The Authors Journal compilation ª 20 05 FEBS R Helland...
- 11
- 551
- 0
Structural basis of protein stability at poly extreme crystal structure of amya at 1 6 a resolution 2
... entire salinity range (Fig 2. 10) The activity profiles of AmyA at different temperatures and pH are shown in Figs 2. 11 and 2. 12 Figure 2. 13 AmyA activity profile Activity assay of AmyA using 20 mM ... crystallographic statistics are summarized in Table 2. 1 40 Figure 2. 5 lAmyA crystal picture Crystals of AmyA, with maximum dimensions of 0.1 x 0.1 x 0.6 mm Table 2. 1 Crystal parameters and data ... report, partially purified AmyA that contained the signal peptide with a His-tag was used for the activity assay From the crystal structure of AmyA it appears that the His-tag and Nterminal signal...
- 33
- 290
- 0
Tài liệu Báo cáo khoa học: Crystal structure of importin-a bound to a peptide bearing the nuclear localisation signal from chloride intracellular channel protein 4 ppt
... ˚ ˚ importin -a: 36.9 A2 for main-chain atoms, 40 .2 A2 for ˚ overall ( 62 total atoms) side-chain atoms and 38.7 A Electron density analysis Both the main-chain and side-chain atoms of the modelled ... that CLIC4 also associates with nuclear transport factor -2 and Ran [2] The nuclear transport factor -2 pathway is normally used for the nuclear import of RanGDP [28 ], but nuclear transport factor -2 ... eiac where the phases (aapo ) are obtained from the apo imporc tin -a structure FEBS Journal 27 8 (20 11) 16 62 1675 ª 20 11 The Authors Journal compilation ª 20 11 FEBS A V Mynott et al Crystal structure...
- 14
- 741
- 0
Tài liệu Báo cáo khoa học: Crystal structure of Klebsiella sp. ASR1 phytase suggests substrate binding to a preformed active site that meets the requirements of a plant rhizosphere enzyme doc
... Crystal structure of Klebsiella phytase PhyK A Tyr249 Thr2 92 K Bohm et al ¨ Tyr249 Thr2 92 Asp291 Asp291 Arg24 Arg24 Asn209 His290 Arg100 Asn209 Arg100 Arg28 Arg28 Thr31 B Thr31 C Fig Schematic ... this domain FEBS Journal 27 7 (20 10) 128 4– 129 6 ª 20 10 The Authors Journal compilation ª 20 10 FEBS 128 5 Crystal structure of Klebsiella phytase PhyK A K Bohm et al ¨ B Fig Crystal structure of Klebsiella ... values increase from G1P over PhyK to AppA by a factor of 22 00 The conformational changes of AppA upon substrate binding facilitate a faster turnover of phytate and are in line with a higher specificity...
- 13
- 766
- 0
Tài liệu Báo cáo khoa học: The crystal structure of human a-amino-b-carboxymuconatee-semialdehyde decarboxylase in complex with 1,3-dihydroxyacetonephosphate suggests a regulatory link between NAD synthesis and glycolysis ppt
... Yanagihara K, Tanabe A, Egashira Y, Sanada H & Shibata K (20 02) Identification and expression of a cDNA encoding human 6 622 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 a- amino-b-carboxymuconate-e-semialdehyde ... diabetic rats FEBS Journal 27 6 (20 09) 6615–6 623 ª 20 09 The Authors Journal compilation ª 20 09 FEBS 6619 Crystal structure of human ACMSD S Garavaglia et al Table Effect of glycolytic intermediates ... Pseudomonas fluorescens reveals a pentacoordinate mononuclear metallocofactor J Am Chem Soc 127 , 122 82 122 90 Li T, Iwaki H, Fu R, Hasegawa Y, Zhang H & Liu A (20 06) a- Amino-b-carboxymuconic-e-semialdehyde...
- 9
- 796
- 0
Tài liệu Báo cáo khoa học: Crystal structure of the catalytic domain of DESC1, a new member of the type II transmembrane serine proteinase family pptx
... Asada Y, Hatakeyama K, Nabeshima K, Sumiyoshi A & Koono M (1997) Analy- Crystal structure of the catalytic domain of DESC1 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 sis of tissue factor and tissue ... from human milk J Biol Chem 27 4, 1 823 7–1 824 2 Shimomura T, Denda K, Kitamura A, Kawaguchi T, Kito M, Kondo J, Kagaya S, Qin L, Takata H, Miyazawa K et al (1997) Hepatocyte growth factor activator ... Nicholls A, Bharadwaj R & Honig B (1993) Grasp – graphical representation and analysis of surface-properties Biophys J 64, A1 66 A1 66 FEBS Journal 27 4 (20 07) 21 48 21 60 ª 20 07 Max-Planck-Insitute of...
- 13
- 588
- 0
Tài liệu Báo cáo khoa học: Crystal structure of the BcZBP, a zinc-binding protein from Bacillus cereus doc
... families database Nucleic Acids Res 30, 27 6 28 0 Handa N, Terada T, Kamewari Y, Hamana H, Tame JRH, Park S-Y, Kinoshita K, Ota M, Nakamura H, Kuramitsu S et al (20 03) Crystal structure of the conserved ... types of GAB catalysis have been identified to date [ 12] which are based either on a single, bifunctional GAB catalyst or on a GAB catalysts pair The available biochemical data on MshB and LpxC are ... ª 20 07 The Authors Journal compilation ª 20 07 FEBS V E Fadouloglou et al References Ivanova N, Sorokin A, Anderson I, Galleron N, Candelon B, Kapatral V, Bhattacharyya A, Reznik G, Mikhailova...
- 11
- 710
- 0
Tài liệu Báo cáo khoa học: Crystal structure of a subtilisin-like serine proteinase from a psychrotrophic Vibrio species reveals structural aspects of cold adaptation docx
... Number of ion pairsa Number of hydrogen bonds Main chain–main chain Main chain–side chain Side chain–side chain Total ˚ Exposed surface areab (A2 ) ˚ Apolarc (A2 ) ˚ Buried surface areab (A2 ) ˚ Apolarc ... E28–K95 D 124 –K153 D188–R270 D201–R249 E253–R249 D257–R270 D257–K275 2. 97 3.00 3.91 2. 79 3 .20 2. 81 3.41 2. 98 2. 80 2. 78 ˚ A ˚ A ˚ A ˚ A ˚ A ˚ A ˚ A ˚ A ˚ A ˚ A a The criterion of conserved ion pairs ... D187–R 12 (E27–87 E48–R80 E50–R 52 D98–K94 D1 12 R147 D117–R 121 D184–R188 D260–R 12 1THM 2. 77 4.65 3.93 2. 95 2. 75 2. 76 2. 94 3. 02 3. 02 ˚ A ˚ A) a ˚ A ˚ A ˚ A ˚ A ˚ A ˚ A ˚ A D57–R1 02 D60–R1 02 D188–K17 E28–K95...
- 14
- 597
- 0
Tài liệu Báo cáo khoa học: The crystal structure of coenzyme B12-dependent glycerol dehydratase in complex with cobalamin and propane-1,2-diol pptx
... Shibata, N., Morimoto, Y., Toraya, T & Yasuoka, N (20 00) How a protein generates a catalytic radical from Ó FEBS 20 02 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 Structure of B 12- dependent ... dehydratase a subunit was amplified by PCR using pUSI2E(GD) [28 ], pfu DNA polymerase (Stratagene) and pairs of primers 5¢-TCTGAGTGCGGTGGAAGAGATG ATGAAGCG-3¢ and 5¢-AGATCTTATTCAATGGTGT CGGGCTGAACC-3¢ ... pUSI2E(aG) DNA segments encoding the b and c subunits of glycerol dehydratase were amplified by PCR using pairs of primers 5¢-CATATGCAACAGACAACCCAAATTCAGCCC-3¢ and 5¢-AGATCTTATCACTCCCTTACTAAGTCGATG-3¢...
- 11
- 602
- 0
Báo cáo khoa học: The crystal structure of NlpI A prokaryotic tetratricopeptide repeat protein with a globular fold potx
... (residues 20 29 4) were 5¢-aataatccatggggagtaatacttcctggcgta aaagtgaagtcc-3¢ and 5¢-attattggatccctattgctggtccgattctgccag-3¢ 3-TPR NlpI primers (residues 62 197) were 5¢-aataatccatgg gggcacagcttttatatgagcgcggag-3¢ ... 2. 5 Helix 11 21 2, 21 6 16 Helix 12 237, 24 0, 24 4 Helix 13 25 5, 25 8, 25 9 ,26 1, 26 2, 26 4, 26 6 16 Helix 14 27 1, 27 5, 27 8 2. 45 Total 38 FEBS Journal 27 2 (20 05) 166–179 ª 20 04 FEBS C G M Wilson et al ... )153.0 +26 .5 16 .2 (pair 3–4) YAHLNRGIALYYGGRDKLAQDDLLAFYQDDPND 164–177 179–1 92 14.6 3.9 +163.3 +26 .9 96 .2 (pair 4–5) PFRSLWLYLAEQKLDEKQAKEVLKQHFEKSDKEQW 10 11 199 20 6 21 2 22 2 12. 9 7.4 +1 72. 6 )26 .0...
- 14
- 433
- 0
Báo cáo Y học: Crystal structure of the catalytic domain of a human thioredoxin-like protein pdf
... smoothly in alternating steps of automatic adjustment with CNS and manual adjustment with the program O [34] The final model has a final R-factor of 0 .22 2 with a free R-factor of 0 .25 3 Molecular graphics ... in length and contains an 867-bp ORF, which encodes for a protein with 28 9 amino acids and a calculated molecular mass of 32 kDa A search of the nonredundant protein sequence database was performed ... using the crystal structure of human thioredoxin in its reduced form as a search model (PDB ID: 1ERT) The structure was refined to a crystallo˚ graphic R-factor of 0 .22 2 at 2. 2 -A resolution (Table...
- 9
- 533
- 0
Báo cáo khoa học: Crystal structure of basic 7S globulin, a xyloglucanspecific endo-b-1,4-glucanase inhibitor protein-like protein from soybean lacking inhibitory activity against endo-b-glucanase doc
... The DASA of the AB dimer is defined as [(ASA of A) + (ASA of B) ) (ASA of AB dimer)] ⁄ The number of water molecules in the dimer interface was detected with ASV CALCULATOR [34] ASA was calculated ... Okada H, Hara S, Ikenaka T, Murao S & Arai M (1990) Cloning and sequence analysis of a cDNA for cellulase (FI-CMCase) from Aspergillus aculeatus Curr Genet 18, 21 7 22 2 Scarafoni A, Ronchi A & ... the surface of soybean 4-kDa peptide involved in the interaction with its binding protein Eur J Biochem ⁄ FEBS 27 0, 25 83 25 92 Yamazaki T, Takaoka M, Katoh E, Hanada K, Sakita M, Sakata K, Nishiuchi...
- 11
- 524
- 0
Báo cáo khoa học: Crystal structure of a glycoside hydrolase family 6 enzyme, CcCel6C, a cellulase constitutively produced by Coprinopsis cinerea pot
... M, Vasella A, Becker D et al (20 02) The active site of cellobiohydro- Structure of C cinerea CcCel6C 21 22 23 24 25 26 27 28 29 30 31 32 lase Cel 6A from Trichoderma reesei: the roles of aspartic ... D405 D 226 N310 W371 N234 H271 G273 W274 W368 G369 T233 N280 W277 (D16)b K20 E314 G 328 W 52 R91 K310 P311 Y86 S 221 D 92 D316 D139 N 222 W2 82 (G147)b (N183)b G185 W186 W279 G280 T146 (K1 92) b W189 a The ... et al crystal structure of a cellulase was reported; it was a catalytic domain of Hypocrea jecorina Cel 6A (HjeCel 6A, formerly designated cellobiohydrolase II), a GH6 cellobiohydrolase from an ascomycete...
- 11
- 489
- 0
Báo cáo khoa học: ˚ cDNA cloning and 1.75 A crystal structure determination of PPL2, an endochitinase and N-acetylglucosaminebinding hemagglutinin from Parkia platycephala seeds potx
... compilation ª 20 06 FEBS 3963 PPL2, an endochitinase from Parkia platycephala B S Cavada et al Fig Purification and molecular mass determination of PPL2 (A) MALDI-TOF mass determination of native PPL2 purified ... compilation ª 20 06 FEBS B S Cavada et al PPL2, an endochitinase from Parkia platycephala Fig Structural features of PPL2 and the GH18 family (A) Multiple sequence alignment of PPL2, hevamine, XIP-I and ... buffer, FEBS Journal 27 3 (20 06) 39 62 3974 ª 20 06 The Authors Journal compilation ª 20 06 FEBS 3969 PPL2, an endochitinase from Parkia platycephala B S Cavada et al and the retained fraction was desorbed...
- 13
- 487
- 0
Báo cáo khoa học: Isolation, characterization, sequencing and crystal structure of charybdin, a type 1 ribosome-inactivating protein from Charybdis maritima agg. potx
... pharmacology of squill New York Acad Med Bull 50, 747–750 Narayanan S, Surolia A & Karande AA (20 04) Ribosome-inactivating protein and apoptosis: abrin causes cell death via mitochondrial pathway ... Journal 27 3 (20 06) 26 84 26 92 ª 20 06 The Authors Journal compilation ª 20 06 FEBS 26 85 Ribosome-inactivating protein from C maritima agg E Touloupakis et al ted IC50 of 27 .2 nm for charybdin is at ... protein, and it was necessary for the crystallization of charybdin Protein concentration was determined by the method of Bradford, using BSA as standard FEBS Journal 27 3 (20 06) 26 84 26 92 ª 20 06 The Authors...
- 9
- 424
- 0
hydrothermal synthesis and crystal structure of a novel one - dimensional tritungstate
... 380 B Yan, et al.r Inorganic Chemistry Communications (20 00) 379–3 82 Fig Packing view of ŽC H 10 N2 wW3 O10 x along the b-axis 2. 4 X-ray Crystallographic Studies X-ray crystallographic data of were ... Siemens Analytical Instruments, Madison, WI, 1994 w15x M.I Khan, Q Chen, J Zubieta, Inorg Chim Acta 21 3 Ž1993 325 w16x K Okada, H Morikawa, F Marumo, S Iwai, Acta Crystallogr B 32 Ž1976 1 522 ... The reaction is then rationalized by using Na 2WO4 as W 6q source instead of WO that gives rise to monophasic product of compound containing large single crystals TGA shows a weight loss of ca ...
- 4
- 379
- 0
Báo cáo khoa học: Crystal structure of RNase A tandem enzymes and their interaction with the cytosolic ribonuclease inhibitor potx
... 6-carboxyfluorescein-dArU(dA )2- 6-carboxytetramethylrhodamine (FAM-AUAA-TAMRA) as substrate] and cytotoxic (IC50 values between 12. 9 lm and 40.0 lm with mammalian K-5 62 cells) All three variants showed thermodynamic stabilities similar to that of ... soluble RI, was loaded onto an RNase A affinity column For affinity chromatography, RNase A was attached covalently to the resin of a 5-mL Crystal structure of RNase A tandem enzymes HiTrap NHS-ester ... 7.0) and crystallization solution (2 lL) Diffraction-quality crystals grew within days at 13 °C to a size of 0.1 · 0.1 · 0.1 mm Structure determination A redundant dataset of a RATE crystal was...
- 10
- 535
- 0
Báo cáo khoa học: Crystal structure of the halotolerant c-glutamyltranspeptidase from Bacillus subtilis in complex with glutamate reveals a unique architecture of the solvent-exposed catalytic pocket docx
... was amplified by PCR from the plasmid pCY167 (Suzuki H & Yamada C, Unpublished), using forward primer 5¢-CATATGGATGAGTACAAACA AGTAGATG-3¢ and reverse primer 5¢-GGATCCTCGAG CTCATTTACGTTTTAAATTAATGCCGAT-3¢ ... Gokhman I, Sussman JL & Zamir A (20 05) Three-dimensional structure of a halotolerant algal carbonic anhydrase predicts halotolerance of a mammalian homolog Proc Natl Acad Sci USA 1 02, 7493–7498 23 ... protein adaptation to a saturated salt environment from the crystal structure of a halophilic 2Fe 2S ferredoxin Nat Struct Biol 3, 4 52 458 22 Premkumar L, Greenblatt HM, Bageshwar UK, Savchenko...
- 10
- 375
- 0
Báo cáo khoa học: The crystal structure of a xyloglucan-specific endo-b-1,4glucanase from Geotrichum sp. M128 xyloglucanase reveals a key amino acid residue for substrate specificity potx
... programs for protein crystallography Acta Crystallogr D 50, 760–763 18 Navaza J (1994) AMoRe: an automated package for molecular replacement Acta Crystallogr A 50, 157–163 19 Brunger AT, Adams ... was refined against ˚ 20 2. 5 A intensity data The crystallographic R factor and free R factor were 0 .23 6 and 0 .27 6, respectively Table summarizes the statistics of X-ray data collection, and the ... Acta Crystallogr D 54, 905– 921 20 Brunger AT (19 92) Free R-value – a novel statistical ¨ quantity for assessing the accuracy of crystal structures Nature 355, 4 72 475 21 Emsley P & Cowtan K (20 04)...
- 7
- 361
- 0
Báo cáo khoa học: Crystal structure of a cold-adapted class C b-lactamase potx
... Asp108–Arg105 Asp185–Lys183 Glu196–Arg210 Glu300–Arg105 Glu2 72 Arg148 21 19 14 0 92 824 8 5844 –1 6.5 No of hydrogen bonds (side chain–side chain) Aromatic stacking ˚ ASA total (A2 ) ˚ ASA apolar (A2 ) ˚ ASA ... Evolution of an enzyme activity: crystallographic structure at 2 -A resolution of cephalosporinase from the ampC gene of Enterobacter cloacae P99 and comparison with a class A penicillinase Proc Natl Acad ... code 2BLT) as a search model The model was ˚ solved to a resolution of 2. 2 A A summary of data collection and refinement statistics is presented in Table Ramachandran plots indicate that 87.7% of...
- 11
- 341
- 0
- the crystal structure of silicon 38
- crystal structure of the low ph form of the vesicular stomatitis virus glycoprotein g187
- crystal structure of glycoprotein b from herpes simplex virus 1 217
- examples of the crystal structure of glycolipids
- c crystal structure of fe l5 2 pf6 2
- d crystal structure of ru l5 2 pf6 2
- b crystal structure of co l8 2 pf6 2 1¾ch3cn
- a crystal structure of l14
- b crystal structure of 2 7 di 2 hydroxyethoxy naphthalene
- a crystal structure of ru l11 2 pf6 4·4 5 c2h5 2o·2ch3cn
- b crystal structure of fe l14 pf6 2· c2h5 2o·½ch3cn
- c crystal structure of fe l15 pf6 2·ch3cn
- crystal structure of pparγ and rxr 8
- crystal structure of pparγ and rxr
- a c structure of nucleus
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các nguyên tắc biên soạn khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn xác định thời lượng học về mặt lí thuyết và thực tế điều tra đối với đối tượng giảng viên và đối tượng quản lí khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu nội dung cụ thể cho từng kĩ năng ở từng cấp độ xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ lồng sóc mở máy động cơ rôto dây quấn các đặc tính của động cơ điện không đồng bộ đặc tuyến hiệu suất h fi p2 đặc tuyến tốc độ rôto n fi p2 đặc tuyến dòng điện stato i1 fi p2 sự cần thiết phải đầu tư xây dựng nhà máy phần 3 giới thiệu nguyên liệu từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng 9 tr 25