c crystal structure of fe l5 2 pf6 2
Metal Complexes of 4′-Substituted-2,2′:6′,2″-Terpyridines in Supramolecular Chemistry
... Absorption spectroscopic characterisation 26 5 7.4 Crystal structures of [{Ru(L11) }2] [PF6 ]2 4⁄5 (C2 H5)2O·2CH3CN, 14 [ {Fe( L )}] [PF6 ]2 (C2 H5)2O·½CH3CN and [ {Fe( L15)}] [PF6 ]2 CH3CN 14 26 6 7.5 Stereochemical ... V: Crystal data of [{Ru(L11) }2] [PF6 ]2 4⁄5 (C2 H5)2O·2CH3CN, [ {Fe( L14)}] [PF6 ]2 (C2 H5)2O·½CH3CN and 15 [ {Fe( L )}] [PF6 ]2 CH3CN 308 Appendix VI: Tables of H NMR spectroscopic data and ES-MS spectra of ... characterisation of [Co(L7 )2] [PF6 ]2 and [Co(L9 )2] [PF6 ]2 143 4.4 Mass spectrometric characterisation 150 4.5 Absorption spectroscopic characterisation 1 52 4.6 Crystal structures of [Co(L )2] [PF6] 2...
- 341
- 258
- 0
Tài liệu Báo cáo khoa học: The crystal structure of human a-amino-b-carboxymuconatee-semialdehyde decarboxylase in complex with 1,3-dihydroxyacetonephosphate suggests a regulatory link between NAD synthesis and glycolysis ppt
... K (20 02) Identification and expression of a cDNA encoding human 6 622 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 a-amino-b-carboxymuconate-e-semialdehyde decarboxylase (ACMSD) J Biol Chem 27 7, ... streptozotocin-induced diabetic rats FEBS Journal 27 6 (20 09) 6615–6 623 ª 20 09 The Authors Journal compilation ª 20 09 FEBS 6619 Crystal structure of human ACMSD S Garavaglia et al Table Effect of glycolytic ... α-amino-β-carboxymuconateε-semialdehyde decarboxylase (ACMSD) COOH CHO N COOH Quinolinic acid COOH NH2 α-aminomuconic acidε-semialdehyde (AMS) non enzymatic Glutaryl CoA N COOH Picolinic acid NAD CO2 + ATP...
- 9
- 796
- 0
Tài liệu Báo cáo khoa học: The crystal structure of coenzyme B12-dependent glycerol dehydratase in complex with cobalamin and propane-1,2-diol pptx
... produce pET19b(H6bG) A pair of synthetic oligonucleotides, 5¢-TATGGGCAGCAGCCATCATCATCATCATCACA GCAGCGGCCTGGTGCCGCGCGGCAGCAC-3¢ and 5¢-TAGTGCTGCCGCGCGGCACCAGGCCGCTGCT GTGATGATGATGATGATGGCTGCTGCCCA-3¢ ... glycerol dehydratase were amplified by PCR using pairs of primers 5¢-CATATGCAACAGACAACCCAAATTCAGCCC-3¢ and 5¢-AGATCTTATCACTCCCTTACTAAGTCGATG-3¢ for the b subunit and 5¢-CATATGAGCGAGAAAACCA TGCGCGTGCAG-3¢ ... N (20 00) How a protein generates a catalytic radical from Ó FEBS 20 02 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 Structure of B 12- dependent glycerol dehydratase (Eur J Biochem 26 9)...
- 11
- 602
- 0
Báo cáo khoa học: Crystal structure of basic 7S globulin, a xyloglucanspecific endo-b-1,4-glucanase inhibitor protein-like protein from soybean lacking inhibitory activity against endo-b-glucanase doc
... program to check the stereochemical quality of protein structures J Appl Crystallogr 26 , 28 3 29 1 27 Schuck P (20 00) Size-distribution analysis of macromolecules by sedimentation velocity ultracentrifugation ... Analysis of a catalytic acidic pair in the active center of cellulase from Aspergillus aculeatus Biosci Biotechnol Biochem 63, 21 57 21 62 33 Lever M (19 72) A new reaction for colorimetric determination ... determined the crystal structure of Bg7S, which is the first three-dimensional structure FEBS Journal 27 8 (20 11) 1944–1954 ª 20 11 The Authors Journal compilation ª 20 11 FEBS 1949 Structure of Bg7S,...
- 11
- 524
- 0
Báo cáo khoa học: The crystal structure of a xyloglucan-specific endo-b-1,4glucanase from Geotrichum sp. M128 xyloglucanase reveals a key amino acid residue for substrate specificity potx
... Y457G mutant was constructed using the QuikChangeÒ procedure (Stratagene) with primers 5¢-TCTTCAGCGGC ATGGGCGACCTCGGCGGCAT-3¢ and 5¢-ATGCCGC CGAGGTCGCCCATGCCGCTGAAGA-3¢ The recombinant protein ... the accuracy of crystal structures Nature 355, 4 72 475 21 Emsley P & Cowtan K (20 04) Coot: model-building tools for molecular graphics Acta Crystallogr D 60, 21 26 21 32 22 Potterton L, McNicholas ... Y (20 02) Purification, characterization, cloning, and expression of a novel xyloglucan-speci c glycosidase, oligoxyloglucan reducing end-speci c cellobiohydrolase J Biol Chem 27 7, 4 827 6–4 828 1...
- 7
- 361
- 0
Báo cáo khoa học: Crystal structure of a cold-adapted class C b-lactamase potx
... 550b 3 1c > 61b 34. 3c 0.6 5c 0.5 2c 0 .2 1c 0.4 2c Nitrocefin Cephalexin Cefazolin Benzylpenicillin Ampicillin Carbenicillin Oxacillin Cloxacillin 116b 5 0c > 150b 2. 3d 5.1d 3.7d 0.118d 0.016d kcat (S)1) ... linear dependence of the FEBS Journal 27 5 (20 08) 1687–1697 ª 20 08 The Authors Journal compilation ª 20 08 FEBS C Michaux et al Psychrophilic class C b-lactamase intrinsic fluorescence of the native ... marcescens kcat ⁄ Km (lM)1Æs)1) C Michaux et al 0.8 0.6 0.4 0 .2 0 Urea concentration (M) Fig Intrinsic fluorescence of the Pse fluorescens TAE4 as a function of the urea concentration at 30 C FEBS...
- 11
- 341
- 0
Crystal structure of arabidopsis thaliana cyclophilin 38 (atcyp38 2
... differences in the cyclophilin domain of AtCyP38 and other known cyclophilin structures (section 4.9 .2) The helical domain and the cyclophilin domain of the structure are connected β1 α1 2 2 GGILLVANPVIPDVSVLISGPPIKDPEALMRYAMPIDNKAIREVQKPME ... Unit-cell parameters Space group C2 22 1 Native Se-Met a (Å) 58 .2 58.1 b (Å) 95.9 96.0 c (Å) 167.5 167 .2 No of molecules in ASU 1 Data collection X-ray source and detector BNL (X -25 ) / ADSCQ-315 CCD ... Asp255 has clusters of charged residues with a net surplus of acidic residues (21 acidic, 16 basic) In other high molecular weight immunophilins, such as CyP40 and FKBP 52, similar clusters of charged...
- 36
- 182
- 0
Structural basis of protein stability at poly extreme crystal structure of amya at 1 6 a resolution 2
... Coordinating atoms of calcium and distances Calcium No Interacting Atoms ASP 44 OD1 ASP 46 OD1 ASP 48 OD1 ILE 50 O ASP 52 OD2 WAT 27 Distance in Å 2. 47 2. 49 2. 50 2. 45 2. 48 2. 70 Calcium No Interacting Atoms ... Distance in Å 2. 59 2. 50 2. 64 2. 58 2. 59 2. 70 Ca 1, the calcium ion, which is coordinated by residues within 44 to 52, is present in most α-amylases, Figs 2. 7, 2. 8 Also, a novel calcium site, Ca2, ... data collection and crystallographic statistics are summarized in Table 2. 1 40 Figure 2. 5 lAmyA crystal picture Crystals of AmyA, with maximum dimensions of 0.1 x 0.1 x 0.6 mm Table 2. 1 Crystal...
- 33
- 290
- 0
Tài liệu Báo cáo khoa học: Crystal structure of an ascomycete fungal laccase from Thielavia arenaria – common structural features of asco-laccases ppt
... 0 .2 61 ± 2. 7 ± 0.1 FEBS Journal 27 8 (20 11) 22 83 22 95 ª 20 11 The Authors Journal compilation ª 20 11 FEBS J P Kallio et al Crystal structure of a Thielavia arenaria laccase Fig (A) The crystal structure ... endospore coat laccase from Bacillus subtilis J Biol Chem 27 9, 23 4 72 23 476 21 Li X, Wei Z, Zhang M, Peng X, Yu G, Teng M & Gong W (20 07) Crystal structures of E coli laccase CueO at different copper concentrations ... pocket are completely different, possibly accounting for the clear differences in reaction kinetics between basidiomycete laccases and asco-laccases Dimerization In the TaLcc1 crystal structure, ...
- 13
- 888
- 0
Tài liệu Báo cáo khoa học: Crystal structure of importin-a bound to a peptide bearing the nuclear localisation signal from chloride intracellular channel protein 4 ppt
... expression of a chloride ion channel of cell nuclei J Biol Chem 27 2, 125 75– 125 82 28 Hu W & Jans DA (1999) Efficiency of importin alpha ⁄ beta-mediated nuclear localization sequence recognition and nuclear ... protein crystallography Acta Crystallogr D: Biol Crystallogr 50, 760–763 37 Evans P (20 06) Scaling and assessment of data quality Acta Crystallogr D: Biol Crystallogr 62, 72 82 38 McCoy AJ, Grosse-Kunstleve ... importin-a (Table 2) The numbers of contacts are comparable with those of the basic residues at P2 (Lys203: 31 contacts), P3 (Lys204: 20 contacts) and P5 (Arg206: 45 contacts) Normalized B factor analysis...
- 14
- 741
- 0
Tài liệu Báo cáo khoa học: Crystal structure of the cambialistic superoxide dismutase from Aeropyrum pernix K1 – insights into the enzyme mechanism and stability pdf
... strictly aerobic hyperthermo- FEBS Journal 27 8 (20 11) 598–609 ª 20 10 The Authors Journal compilation ª 20 10 FEBS 607 Crystal structure of SOD from A pernix K1 17 18 19 20 21 22 23 24 25 26 27 ... (1993) PROCHECK – a program to check the stereochemical quality of protein structures J Appl Crystallogr 26 , 28 3 29 1 Crystal structure of SOD from A pernix K1 42 Emsley P & Cowtan K (20 04) Coot: ... dimensions Acta Crystallogr D: Biol Crystallogr 60, 22 56 22 68 44 DeLano WL (20 02) The PyMol Molecular Graphics System DeLano Scienti c, San Carlos, CA, USA FEBS Journal 27 8 (20 11) 598–609 ª 20 10 The...
- 12
- 762
- 0
Tài liệu Báo cáo khoa học: Crystal structure of Klebsiella sp. ASR1 phytase suggests substrate binding to a preformed active site that meets the requirements of a plant rhizosphere enzyme doc
... Kleb(HtoA)fw (5¢-GCTTAGCCGCGCCGGCATTCG) and Kleb(HtoA)rv (5¢-CGAATGCCGGCGCGGCTAAGC) as primers for FEBS Journal 27 7 (20 10) 128 4– 129 6 ª 20 10 The Authors Journal compilation ª 20 10 FEBS K Bohm et ... Cloning of the Klebsiella phytase gene (phyK) The Klebsiella phytase gene phyK was amplified using primers KlebTH-fw (5¢-TCGGATCCGCCGCCGCGCGAC TGGCAGCTG) and KlebTH-rv (5¢-CCGGCGGTAGC CATGGTCCTGCCGAAGCTT) ... substrates The scissile 3-phosphate is located deep inside the catalytic pocket FEBS Journal 27 7 (20 10) 128 4– 129 6 ª 20 10 The Authors Journal compilation ª 20 10 FEBS 128 7 Crystal structure of Klebsiella...
- 13
- 766
- 0
Tài liệu Báo cáo khoa học: Crystal structure of the catalytic domain of DESC1, a new member of the type II transmembrane serine proteinase family pptx
... structural features underlying the specificity FEBS Journal 27 4 (20 07) 21 48 21 60 ª 20 07 Max-Planck-Insitute of Biochemistry Journal compilation ª 20 07 FEBS 21 51 Crystal structure of the catalytic ... stem regions of FEBS Journal 27 4 (20 07) 21 48 21 60 ª 20 07 Max-Planck-Insitute of Biochemistry Journal compilation ª 20 07 FEBS 21 55 Crystal structure of the catalytic domain of DESC1 DESC1 ⁄ hepsin, ... structure of the catalytic domain of DESC1 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 sis of tissue factor and tissue factor pathway inhibitor expression in human colorectal carcinoma cell lines...
- 13
- 588
- 0
Tài liệu Báo cáo khoa học: Crystal structure of the BcZBP, a zinc-binding protein from Bacillus cereus doc
... (%) GlcNAc (GlcNAc )2 (GlcNAc)3 (GlcNAc)4 (GlcNAc)5 (GlcNAc)6 100 89. 82 10.51 5.51 12. 19 3.93 molecule in the active site and the binding of acetate, strongly suggest that BcZBP acts as a zinc-dependent ... Journal compilation ª 20 07 FEBS V E Fadouloglou et al Crystal structure of BcZBP from B cereus Fig Model of the BcZBP–GlcNAc complex Stereoview of the energy minimized putative BcZBP–GlcNAc complex ... formation of two, FEBS Journal 27 4 (20 07) 3044–3054 ª 20 07 The Authors Journal compilation ª 20 07 FEBS 3045 Crystal structure of BcZBP from B cereus V E Fadouloglou et al A B Fig Structure of the BcZBP...
- 11
- 710
- 0
Tài liệu Báo cáo khoa học: ˚ The 1.8 A crystal structure of a proteinase K-like enzyme from a psychrotroph Serratia species docx
... enzymes: molecular basis of cold adaptation Cell Mol Life Sci 53, 830–841 25 Feller G (20 03) Molecular adaptations to cold in psychrophilic enzymes Cell Mol Life Sci 60, 648–6 62 26 Kristjansson ... not yet clear to what extent this interaction would affect PRK specificity at the S2 site FEBS Journal 27 3 (20 06) 61–71 ª 20 05 The Authors Journal compilation ª 20 05 FEBS 65 Structure of proteinase ... the S1¢ and S2¢ binding site of SPRK The 2fofc electron density is contoured at 1.0 r FEBS Journal 27 3 (20 06) 61–71 ª 20 05 The Authors Journal compilation ª 20 05 FEBS 67 Structure of proteinase...
- 11
- 551
- 0
Tài liệu Báo cáo khoa học: Crystal structure of a subtilisin-like serine proteinase from a psychrotrophic Vibrio species reveals structural aspects of cold adaptation docx
... intermolecular interactions, less FEBS Journal 27 2 (20 05) 8 32 845 ª 20 05 FEBS Structural aspects of cold adaptation compact packing of the hydrophobic core, an increased apolar surface area, decreased ... D188–K17 E28–K95 D 124 –K153 D188–R270 D201–R249 E253–R249 D257–R270 D257–K275 2. 97 3.00 3.91 2. 79 3 .20 2. 81 3.41 2. 98 2. 80 2. 78 ˚ A ˚ A ˚ A ˚ A ˚ A ˚ A ˚ A ˚ A ˚ A ˚ A a The criterion of conserved ion ... (20 05) 8 32 845 ª 20 05 FEBS ´ ´ J Arnorsdottir et al 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 Structural adaptations to cold and investgation of the active site J Biol Chem 27 8, 7531–7539...
- 14
- 597
- 0
Tài liệu Báo cáo khoa học: Crystal structure of Trypanosoma cruzi glyceraldehyde-3-phosphate dehydrogenase complexed with an analogue of 1,3-bisphospho-D-glyceric acid Selective inhibition by structure-based design docx
... Bre´sil (COFECUB) (contract no 29 4 H99) which is fully acknowledged We acknowledge La socie´te´ de Secours des Amis des Sciences and the European Cooperation in the Field of Scienti c and Technical ... Biolabs) with the corresponding reaction buffer PCR was carried out using the following programme: first at 95 C; 30 cycles of at 95 C, at 50 C, at 72 C; a final incubation of 10 at 72 C The amplified ... Park, H.W (20 00) Structural analysis of glyceraldehyde-3-phosphate dehydrogenase from Escherichia coli: direct evidence of substrate binding and cofactorinduced conformational changes Biochemistry...
- 13
- 588
- 0
Tài liệu Báo cáo khoa học: Crystal structure of thiamindiphosphate-dependent indolepyruvate decarboxylase from Enterobacter cloacae, an enzyme involved in the biosynthesis of the plant hormone indole-3-acetic acid doc
... lipoferum and Klebsiella aerogenes) are shown in red in the EcIPDC sequence (DCIP_ENTCL) Residues conserved in 12 PDC sequences (DCP1_MAIZE, DCP1_ORYSA, DCP1_PEA, DCP2_TOBAC, DCP2_ORYSA, DCPY_ZYMMO, ... decarboxylase involved in 23 20 A Schutz et al (Eur J Biochem 27 0) ¨ 10 11 12 13 13a 14 15 16 17 18 19 20 21 22 23 24 25 26 indole-3-acetic acid synthesis in Erwiniaherbicola Appl Environ Microbiol ... FEBS 20 03 3D structure of indolepyruvate decarboxylase (Eur J Biochem 27 0) 23 17 Fig Quaternary structure of IPDC Upper panel: stereo view of the quaternary structure of IPDC from Enterobacter cloacae...
- 10
- 557
- 0
Báo cáo khoa học: Crystal structure of salt-tolerant glutaminase from Micrococcus luteus K-3 in the presence and absence of its product L-glutamate and its activator Tris pdf
... (20 04) Developments in the CCP4 molecular-graphics project Acta Crystallogr D Biol Crystallogr 60, 22 88 22 94 44 Potterton E, McNicholas S, Krissinel E, Cowtan K & Noble M (20 02) The CCP4 molecular-graphics ... Arg 223 and Ser 227 interact with Tris Tris binding in the TG structure seems to be coupled to the protein local structure in the region encompassing aa 22 2 -22 8, which is distinct from the corresponding ... Moriguchi M (20 06) Crystal structure of a major fragment of the salt-tolerant glutaminase from Micrococcus luteus K-3 Biochem Biophys Res Commun 346, 1118–1 124 Madern D, Ebel C & Zaccai G (20 00)...
- 11
- 521
- 0
Báo cáo khoa học: The crystal structure of NlpI A prokaryotic tetratricopeptide repeat protein with a globular fold potx
... 5¢-aataatccatggggagtaatacttcctggcgta aaagtgaagtcc-3¢ and 5¢-attattggatccctattgctggtccgattctgccag-3¢ 3-TPR NlpI primers (residues 62 197) were 5¢-aataatccatgg gggcacagcttttatatgagcgcggag-3¢ and 5¢-aataatggatcctcactgttc cttatccgatttttcgaagtgc-3¢ ... Sciences and Division of Chemical Sciences, under Contract No DE-AC 02 98CH10886 X1 2C is supported principally by the Of ces of Biological and Environmental Research and of Basic Energy Sciences ... 25 5, 25 8, 25 9 ,26 1, 26 2, 26 4, 26 6 16 Helix 14 27 1, 27 5, 27 8 2. 45 Total 38 FEBS Journal 27 2 (20 05) 166–179 ª 20 04 FEBS C G M Wilson et al Crystal structure of NlpI pendent domain One could therefore...
- 14
- 433
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các mục tiêu của chương trình khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản xác định thời lượng học về mặt lí thuyết và thực tế tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra đối với đối tượng giảng viên và đối tượng quản lí khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam nội dung cụ thể cho từng kĩ năng ở từng cấp độ xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct mở máy động cơ lồng sóc mở máy động cơ rôto dây quấn các đặc tính của động cơ điện không đồng bộ hệ số công suất cosp fi p2 đặc tuyến mômen quay m fi p2 đặc tuyến dòng điện stato i1 fi p2 sự cần thiết phải đầu tư xây dựng nhà máy thông tin liên lạc và các dịch vụ phần 3 giới thiệu nguyên liệu chỉ tiêu chất lượng 9 tr 25