3 1 hydroxylase as determined by genetic mouse models
Tài liệu Báo cáo khoa học: Si-face stereospecificity at C5 of coenzyme F420 for F420H2 oxidase from methanogenic Archaea as determined by mass spectrometry ppt
... [5-1H]F420 from its elemental composition considering the isotope composition of the elements: 98.9% 12 C, 1. 1% 13 C; 99. 63% 14 N, 0 .37 % 15 N; 99.99% 1H, 0. 01% 2H; and 99.76% 16 O, 0.24% 17 O and 18 O ... Schonheit P, Keweloh H & Thauer RK (19 81) Factor ¨ F420 degradation in Methanobacterium thermoauto- FEBS Journal 272 (2005) 533 7– 534 2 ª 2005 FEBS H Seedorf et al 10 11 12 13 trophicum during exposure ... hydrogenase (Frh) [12 , 13 ] ; F420-dependent formate dehydrogenase (Frd) [14 ]; F420-specific alcohol dehydrogenase (Adf) [6]; F420-dependent methylenetetrahydromethanopterin dehydrogenase (Mtd) [15 ,16 ];...
Ngày tải lên: 20/02/2014, 03:20
American Negro Slavery A Survey of the Supply, Employment and Control of Negro Labor as Determined by the Plantation Regime docx
... bozal negroes CHAPTER I 10 [Footnote 12 : Las Casas, Historio de las Indias (Madrid, 18 75, 18 76); Arthur Helps, Life of Las Casas (London, 18 73) ; Saco, _op cit_., pp 62 -10 4.] The crown here had ... barely one-tenth as many as the negroes The slaves were reported at 86,546 in 1 734 ; 11 2,428 in 17 44; 16 6, 914 in 17 68; and 210 ,894 in 17 87 In addition there were at the last date some 10 ,000 negroes ... d'ye massa?'"[ 13 ] [Footnote 10 : Lord Chesterfield, Letters to his Son (London, 17 74), II, 525.] [Footnote 11 : H.N Coleridge, _Six Months in the West Indies_, 4th ed (London, 1 832 ), pp 13 1 , 13 2 .]...
Ngày tải lên: 08/03/2014, 00:20
Báo cáo Y học: Characteristics of binding of insulin-like growth factor (IGF)-I and IGF-II analogues to the type 1 IGF receptor determined by BIAcore analysis pptx
... ± ± 1. 16 1. 07 0.88 1. 90 0.94 ± ± ± ± ± ± 4.29 4.25 2.44 5.20 3. 25 88.6 16 1.0 53. 4 48.2 945.0 ND 1. 00 1. 01 1.76 0. 83 1 .32 0.05 0. 03 0.08 0.09 0.005 ND 1. 00 0. 51 0.97 ± ± 2 .35 2.90 2.25 ± ± 23. 50 ... Leu24 des-(2 ,3) -Leu24 Ala 31 des-(2 ,3) -Ala 31 Leu60 Ala31Leu60 IGF-II and analogues IGF-II Des- (1 6) Arg6 Leu27 Des- (1 6 ,10 )-Leu27 kd ´ 10 )3 (1/ s) Kd ´ 10 )9 (M) Relative Kd 2.70 2.52 3. 60 3. 65 2.89 ... af®nity for IGF1R on 964 B E Forbes et al (Eur J Biochem 269) A E 18 0 A 18 0 10 0 12 0 10 0 20 80 20 50 450 50 850 B 450 850 40 F 18 0 13 0 10 0 70 20 10 50 450 850 0 50 450 850 G C 18 0 50 10 0 30 10 20 50...
Ngày tải lên: 08/03/2014, 22:20
Báo cáo Y học: Substrate specificity of human kallikrein 2 (hK2) as determined by phage display technology docx
... 2.69 2 .37 2.27 1. 89 ND ND ND 84.4 89.7 97.9 96.2 57 .1 61. 9 55.8 47.2 33 .1 43. 4 33 .1 23. 2 24.7 32 .4 35 .1 30 .5 33 .1 30 .9 27 .1 24.6 23. 5 26.2 22.9 19 .6 16 .1 13 . 1 19 .1 11. 2 ND ND ND 19 284 16 926 14 ... Clone 6 .1 6.6 6.8 6 .11 6 .19 5.5 5.2 8 .3 6.2 8 .11 8.20 8.5 8.9 8 .18 6.7 8. 13 5 .3 8 .17 6.9 6.20 5 .19 5 .16 5 .18 5 .12 6 .17 6.4 6 .14 6.5 8 .12 8 .14 5 .11 6 .15 5.7 6 .12 5 .1 5 .14 6. 13 8 .19 5.4 5 .10 6 .3 Scissile ... 19 .1 11. 2 ND ND ND 19 284 16 926 14 982 14 605 9646 7659 5765 538 9 515 8 5020 435 8 35 45 34 36 32 99 32 82 30 42 2756 2548 2 512 2289 215 8 19 17 17 72 17 05 14 17 12 48 11 96 99 ND ND ND Rst E-04 E-04 E-04 E-04...
Ngày tải lên: 31/03/2014, 23:20
Báo cáo lâm nghiệp: "Seasonal variations in photosynthetic activity of spruces as determined by chlorophyll fluorescence" ppsx
... mainly healthy (Althof, damage class 0 /1) and of damaged spruce trees (Mauzenberg, damage class 3/ 4) were measured using different fluorescence methods 1) The red laser-induced chlorophyll fluorescence ... springtime (values of 0 .35 -0.45) The ratio of the chlorophyll fluorescence intensity at the maxima near 690 and 735 nm (F690/F 735 ) was about 0.9 81. 08 in normal green needles and ca 1. 21. 6 in the light ... increased again This increase was particularly strong in the 19 87 needles, which in the 1st yr still had a very low chlorophyll content In the case of the damaged spruce, the 19 87 needles showed,...
Ngày tải lên: 09/08/2014, 04:20
Tài liệu Báo cáo khoa học: Structure of the putative 32 kDa myrosinase-binding protein from Arabidopsis (At3g16450.1) determined by SAIL-NMR docx
... MBPfromB.napus194 -33 6 MBPfromB.napus356-498 At1g52 030 .2 -15 4 At1g52 030 .16 1-289 At1g52 030 .4 91- 634 At3g16400.2 -14 2 At3g16440.2 -14 4 At3g16440 .15 4 -30 0 At3g16470.2 -14 5 At3g16470 .15 8-297 At3g16470 .30 8-450 At3g2 13 8 0.7- 13 0 ... MBPfromB.napus1 -12 5 MBPfromB.napus194 -33 6 MBPfromB.napus356-498 At1g52 030 .2 -15 4 At1g52 030 .16 1-289 At1g52 030 .33 6-476 At3g16400.2 -14 2 At3g16440.2 -14 4 At3g16440 .15 4 -30 0 At3g16470.2 -14 5 At3g16470 .15 8-297 At3g16470 .30 8-450 ... AQKVEAGGGAGGASWDDG-VHDGVRKVHVGQGQDGVSSINVVYAKDSQDVEGGEHGKKTL At3g16450.1C MBPfromB.napus1 -12 5 MBPfromB.napus194 -33 6 MBPfromB.napus356-498 At1g52 030 .2 -15 4 At1g52 030 .16 1-289 At3g16400.2 -14 2 At3g16440.2 -14 4 At3g16440 .15 4 -30 0 At3g16470.2 -14 5 At3g16470 .15 8-297...
Ngày tải lên: 18/02/2014, 14:20
Báo cáo khoa học: Receptor- and calcium-dependent induced inositol 1,4,5-trisphosphate increases in PC12h cells as shown by fluorescence resonance energy transfer imaging pot
... Meldolesi J (19 85) Muscarinic receptor-induced phos- 515 6 16 17 18 19 20 21 22 23 phoinositide hydrolysis at resting cytosolic Ca2+ concentration in PC12 cells J Cell Biol 10 0, 13 3 0– 13 3 3 Bennett ... stores via the Ins (1, 4,5)P3 receptor, a mechanism referred to as Ins (1, 4,5)P3-induced calcium release [3] The pattern of calcium increase via Ins (1, 4,5)P3-induced calcium release has been shown to ... receptor kinase or PKC [ 21, 22], it is less likely that calcium increases Ins (1, 4,5)P3 metabolism by inhibiting receptor desensitization, inasmuch as the reduction in Ins (1, 4,5)P3 metabolism by receptor...
Ngày tải lên: 30/03/2014, 03:20
Báo cáo khoa học: Binding areas of urokinase-type plasminogen activator– plasminogen activator inhibitor-1 complex for endocytosis receptors of the low-density lipoprotein receptor family, determined by site-directed mutagenesis doc
... FEBS 514 9 515 0 2.69 0.26 0.0 51 5.4 2 .30 0.74 1. 43 2.54 3. 86 18 .9 1. 12 0.60 3. 63 0 .36 8 1. 96 0.56 1. 17 0. 83 Wild-type R178 (35 )A-R179 (36 )A-R1 81 (37 a)A Wild-type R178 (35 )A-R179 (36 )A-R1 81 (37 a)A ... 1. 22 1. 22 Kd (nM) k1 ã 10 )5 (M )1 s )1) VLDLR binding k )1 ã 10 4 (s )1) 0.47 k1 ã 10 )5 (M )1 s )1) LRP -1 A binding k )1 ã 10 4 (s )1) Kd (nM) 0.054 7.05 (10 ) 6. 53 (10 ) 6. 73 (10 ) 3. 12 (9) 4.20 1 .37 ... 3. 72 1. 00 3. 24 0. 53 3. 31 3. 14 0.99 0.480 (10 ) 0.704 (10 )c 1. 02 (9)a 5.66 (9)b 3. 01 (10 ) 4.00 (10 ) 5.96 (9)a 8. 43 (9)b 0.226 (4) 0 .36 7 (3) c 1. 02 (4)a 8.79 (4)b 1. 15 4.59 (4) 5.27 (3) 10 .3 (4)a...
Ngày tải lên: 30/03/2014, 10:20
Báo cáo khoa học: Reduction of S-nitrosoglutathione by human alcohol dehydrogenase 3 is an irreversible reaction as analysed by electrospray mass spectrometry pptx
... ADH3wt ADH3-Arg 115 Ser ADH3-Arg 115 Lys ± 0.6 270 ± 70 15 0 ± 50 11 5 ± 13 5 ± 10 15 0 ± 58 000 500 10 00 27 ± 700 ± 250 14 0 ± 30 a Values were determined under nonsaturating conditions kcat/Km (min )1 mM )1) ... ADH3-Arg 115 Ser ADH3-Arg 115 Lys 90 ± 80 ± 11 0 ± 20 13 000 730 0 10 000 ± 2.5 10 ± 8±2 2700 ± 400 18 00 ± 800 19 00 ± 400 34 0 000 18 0 000 240 000 36 00 ± 550 ND ND 11 0 ± 16 ND ND 30 >5000 a kcat (min )1) Km (lM) ... (min )1 mM )1) kcat (min )1) a 2400 ± 400 2750 ± 800 34 00 ± 400 a 90 000 39 00 24 000 a a 600 ND ND ND Values were determined under nonsaturating conditions a ± 1. 5 11 ± 2.8 11 ± ADH3wt ADH3-Arg 115 Ser ADH3-Arg 115 Lys...
Ngày tải lên: 31/03/2014, 07:20
Designation: C 51 – 00a - Lime and Limestone (as used by the Industry)1 pptx
... standard may be obtained by contacting ASTM at the above address or at 610 - 832 -9585 (phone), 610 - 832 -9555 (fax), or service@astm.org (e-mail); or through the ASTM website (www.astm.org) ... sizes commonly recognized are as follows: (1) large lump—8 in (2 03 mm) and smaller, (2) pebble or crushed— 21 2in (64 mm) and smaller, (3) ground, screened or granular 1 4 in (6.4 mm) and smaller, ... magnesian, or dolomitic (1) dolomitic limestone—limestone containing from 35 to 46 % magnesium carbonate (MgCO3) (2) magnesium limestone—a limestone containing from to 35 % MgCO3 (3) high-calcium limestone—a...
Ngày tải lên: 10/07/2014, 23:20
Báo cáo khoa học: " The inhibition of assembly of HIV-1 virus-like particles by 3-O-(3'''',3''''-dimethylsuccinyl) betulinic acid (DSB) is counteracted by Vif and requires its Zinc-binding domain" pdf
... Journal 2008, 5 :16 2 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 Xiao Z, Ehrlich E, Yu Y, Luo K, Wang T, Tian C, X-F Y: Assembly of HIV -1 Vif-Cul5 E3 ubiquitin ligase through a ... acidic phospholipids J Virol 19 94, 68:2556-2569 Aiken C, Chen CH: Betulinic acid derivatives as HIV -1 antivirals Trends Mol Med 2005, 11 : 31 -36 13 14 15 16 17 18 19 20 21 22 23 24 25 26 Pettit S, Moody ... and mutants wt subA subB subC subC 17 0 KRA8 S 116 V C 13 3 S 61 DARLVITTYW wt subA subB subC subC 17 0 KRA8 S 116 V C 13 3 S 10 6 loop1 LIHLH YFDCFSESAI - ...
Ngày tải lên: 12/08/2014, 04:21
Báo cáo y học: " Caveolin-1 and -2 in airway epithelium: expression and in situ association as detected by FRET-CLSM" pps
... (bp) Position of amplified DNA (bp) cav -1 Z46 614 .1 1 23 25 14 7 cav -1 Z46 614 .1 1 21 165–285 cav-2 BC062059 .1 106 39 2–497 cav-2 BC062059 .1 127 17 6 30 2 β-MG NM_ 012 512 Forward: CAGCATGTCTGGGGGTAAAT Reverse: ... Lisanti MP: Caveolin -1 null mice are viable but show evidence of hyperproliferative and vascular abnormalities J Biol Chem 20 01, 276 :38 12 1 -38 13 8 22 23 24 25 26 27 28 29 30 31 32 33 34 Drenckhahn D, ... the manuscript 16 19 20 21 References 10 11 12 13 14 15 Razani B, Woodman SE, Lisanti MP: Caveolae: from cell biology to animal physiology Pharmacol Rev 2002, 54: 4 31 -467 Cohen AW, Hnasko R, Schubert...
Ngày tải lên: 12/08/2014, 16:20
Báo cáo sinh học: " Genetic architecture of trout from Albania as revealed by mtDNA control region variation" ppsx
... Ad-AL1 Ad-AL2 Ad-AL3 AdRc AdN AdPe AdPrz AdBoz AdTi AdC1 AdM1 AdZ1 ADs3 Ad4 Ad 11 EU359770 EU359768 EU359769 EU3 91 632 DQ29 717 2 DQ 318 126 DQ 318 129 DQ 318 128 DQ 318 127 DQ3 815 67 DQ3 815 66 DQ3 815 65 AY260 518 ... DQ3 815 68 DQ3 815 69 DQ3 815 70 EU3597 71 AY 836 365 AF3 219 95 MEcs1 MEcs10 MEcs7 ATcs1 AT11a ATs12 Das1 Da2 DaVl Haplo1 Haplo4 Haplo5 Haplo6 AY 836 350 AY 836 359 AY 836 356 DQ8 411 92 AY185578 AY 836 328 AY185568 ... AY260520 AY6 532 18 Ad12 ADcs1 ADcs 11 ADcs15 ADcs20 Haplo12 Haplo 13 Haplo14 Haplo15 Haplo16 Haplo17 Haplo18 Ma-AL1 MAcs1 MA2 AY6 532 16 AY 836 330 AY 836 340 AY 836 344 AY 836 349 AY926570 AY9265 73 AY9265 71 AY926572...
Ngày tải lên: 14/08/2014, 13:21
Genetic diversity of populations of the malesian moss, acanthorrhynchium papillatum, as measured by microsatellite markers and ITS2 sequences
... 10 7 3. 3.4 Microsatellite diversity within sampling areas 11 1 3. 3.5 Multi-locus genotypic diversity within sampling areas 1 23 3 .3. 6 Genetic distances 13 0 3. 3.7 ... rarefaction 11 8 3. 11 Private alleles with rarefaction 11 9 3. 12 Gene diversities of each sampling site 12 1 3. 13 Details on samples with null ... 13 1 3. 7 Neighbor-joining tree of GBFR samples 13 2 3. 8 Neighbor-joining tree of KTP samples 13 3 3. 9 Neighbor-joining tree of BTNR samples 13 4 3. 10 ...
Ngày tải lên: 13/09/2015, 20:34
Tài liệu Tài liệu nuôi tôm chính thống (Cẩm nang câu hỏi dành cho người nuôi tôm) phần 3 (1).pdf
... viên với tổng diện tích ao nuôi 38 ha (12 0 ao nuôi) Năm 2006, tổng doanh thu tổ đạt 4,2 tỷ đồng trừ chi phí đạt lợ nhuận 1, 2 tỷ đồng (bình quân 81 triệu đồng /1 tổ viên /1 năm) Rõ ràng hiệu từ mô hình ... thí nghiệm cảm nhiễm thực sau sử dụng vacxin 3, 21 ngày Tỉ lệ sống cao có ý nghĩa quan sát sau tôm sử dụng vacxin 3, ngày (64% 77%), bảo vệ giảm sau 21 ngày (tỉ lệ sống 29%) Trái với hiểu biết ... WSSV VP19 VP28 Vacxin chứa VP28 cho thấy tỉ lệ chết tôm thấp có ý nghĩa so sánh với lô đối chứng (vi khuẩn chứa vector rổng) thông qua phương pháp ngâm (tỉ lệ sống 61% ), vacxin chứa VP19 bảo...
Ngày tải lên: 24/09/2012, 11:01
Công nghiệp silicat 3.1
... (Na,Ca)0 ,3( Al,Mg)2Si4O10(OH)2·n(H2O) Màu: trắng, trắng xám, vàng, vàng nâu hay vàng lục Độ cứng: 1, 5 – Khối trọng riêng: – 2,7 g/cm3 Na2O 1, 13 % H2O 36 ,05 % CaO 1, 02 % Al2O3 18 ,25 % SiO2 43, 55 % * Gồm ... g/cm3 H 2O 4,62 K 2O 11 , 81 SiO2 45, 21 Al2O3 38 ,36 Biotite Công thức phân tử: K2O.4MgO.Al2O3 6SiO2.H2O Màu: nâu tối, nâu lục, nâu đen, vàng, trắng Độ cứng: 2,5 – Khối trọng riêng: 2,8 – 3, 4 g/cm3 ... g/cm3 H2O 13 , 96% SiO2 46,54% Al2O3 39 ,5% * Kích thước hạt từ 0 ,1 – µm * Độ phân tán nước cao, độ dẻo cao caolinit Khoáng montmorillonite Công thức phân tử: Al2O3.4SiO2.H2O + nH2O (Na,Ca)0 ,3( Al,Mg)2Si4O10(OH)2·n(H2O)...
Ngày tải lên: 04/10/2012, 12:06
Bản đồ tin học và hệ thông thông tin địa lý Gis - Chương 3.1
... protein Factor Xa Urokinase Human transferrin receptor MAb Chuột (g/l) 35 10 1 0,2 0 ,1 8 -14 0,2 0,2 0,0 01 0 ,3 1 Dê (g/l) 20 10 14 3. 1 .3 Tạo giống vật nuôi kháng bệnh thay đổi điều kiện môi trường Ðến ... thuật công nghệ sinh học sử dụng lần thỏ (Daizien, 19 71) , sau bò lợn (Iritani, 19 78), dê (Kim, 19 81) Vào năm 19 82, bê sinh thụ tinh in vitro (Hanada, 19 82) Từ đến kỹ thuật thụ tinh in vitro áp dụng ... sản ngắn mà có trọng lượng lớn gấp 11 lần so với cá hồi không chuyển gen (Hình 3. 2 ) Hình 3. 2 Cá hồi chuyển gen hormone sinh trưởng có trọng lượng lớn gấp 11 lần so với đối chứng Ở Việt nam,...
Ngày tải lên: 08/10/2012, 13:59
Giáo trình vi sinh vật 3.1
... Acetat CH4 + CO2 Năng lượng giải phóng G0’ (kJ/ methane) 13 5 ,6 13 0 ,1 36 ,5 11 6 ,3 11 2,5 10 4,9 75,0 73, 2 74 ,3 73, 8 31 ,0 Những nơi thông thường tìm thấy cổ khuẩn sinh methane bể ... Escherichia coli 2,5 x 10 Da, ADN Thermoplasma acidophilum 0,8 x 10 Da, hay Methanobacterium 1, 1 x 10 9 Da Ngoài thành phần GC (mol%) ADN cổ khuẩn dao động phạm vi lớn, từ 21 đến 68 %, chứng tỏ ... liệu, hoá chất: Dung dịch A: Acid tannic 5g FeCl3 1, 5 g Formalin ml NaOH 1% ml Nước cất 10 0 ml Dung dịch B: g AgNO3 hoà tan 10 0 ml nước cất, lấy 10 ml dể riêng Nhỏ dung dịch NH4OH đậm đặc vào...
Ngày tải lên: 09/10/2012, 08:37
