2 6 performance requirements for heat rejection equipment

... DAVID [63 ], GeneCards [64 ], COPE [65 ] and Bioinformatic Harvester [66 ] Volume 8, Issue 1, Article R8 R8.14 Genome Biology 20 07, 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 ... Before treatment (Px-PB1) q 12, 2D q 12, 4D ii iii q24,8D iv 23 genes 65 genes 26 3 56 genes 20 0 23 65 18 v refereed research 23 deposited research i After treatment (Px-PB3) q24,4D reports (c) 22 ... Nature Genetics 20 00, 24 :22 7 -23 5 Genome Biology 20 07, 8:R8 http://genomebiology.com /20 07/8/1/R8 63 66 67 68 69 71 Panelli et al R8.15 reviews 70 DAVID Bioinformatics Resource 20 06 [http:// david.abcc.ncifcrf.gov/]...

Ngày tải lên: 14/08/2014, 17:22

... www.verypdf.com to remove this watermark forgive 323 misleading - for forecasts for earnings forecasts for different sectors of the industry 0forecasts for the year forecast verb • ADY accurately, correctly ... Ifelt thefull force of her criticism meet force with force The country's attempts to meet force tcith force (= resist an attack using force) led to the outbreak of war the use of force The regulations ... drioing force behind the project - for Competition is a force for change in forbid verb strictly Smoking is strictly forbidden I absolutely, totally, utterly You cannot that I absolutely forbid...

Ngày tải lên: 19/08/2013, 09:54

... Maximum profit performance for a generalized irreversible Carnot heat pump cycle Termotehnica, 20 08, 12( 2): 22 - 26 [28 ] Zheng Z, Chen L, Sun F, Wu C Maximum profit performance for a class of universal ... variable-temperature heat reservoir Brayton heat pump cycle Figure Π vs β and uH for irreversible variable-temperature heat reservoir Brayton heat pump cycle ISSN 20 76 -28 95 (Print), ISSN 20 76 -29 09 (Online) 20 10 ... J., 19 96, 21 ( 12) : 1 127 -1134 [23 ] Chen L, Wu C, Sun F Effect of heat transfer law on finite time exergoeconomic performance of a Carnot refrigerator Exergy, An Int J., 20 01, 1(4): 29 5-3 02 [24 ] Wu...

Ngày tải lên: 05/09/2013, 15:28

... V23D8D:JED49 567 5HJ5949 62 E23D43JED49 567 G543PJ97G 567 G733JP756D37:E BT@@T@T, #DPD6DE25 12: J9DM07 560 5G4:H7 [ [ !49 .62 E23D43JED49 567 G5IJ3ED7G579 1JE23DJ05DG4HJ9E 567 5HS2H2179E 567 371IHJ:7179E57E 560 5G4:H7 ... )7G5 62 : DGD49G5405J::436G5488D:D7HG 567 5HJ5

Ngày tải lên: 25/12/2013, 10:47

... Rated current A 10 12 16 20 25 32 40 50 63 80 1O0 125 160 20 0 25 0 315 400 500 63 0 800 O00 125 0 Cross-sởctionai area rnmZ 1,5 1,5 23 2. 5 2. 5 10 16 25 25 35 50 70 95 120 185 24 0 x 150 or x (30 x ... Licensee=/5943408001, 03 /29 /20 04 21 :20 : 46 MST Questions or comments about this message: please call the Document Policy Group at 303-397 -22 95 IEC 26 7 P T * A b 4844Aợl 0 023 738 26 9 -2 O CE1 19 86 -2- SOMMAIRE ... fuse-links 25 7 (1 968 ) Fuse-holders for miniature cartridge fuse-links Amendment No (1980) 26 9: - Low-voltage fuses 26 9-1 (19 86) Part 1: General requirements 26 9 -2 (19 86) Part 2: Supplementary requirements...

Ngày tải lên: 25/12/2013, 10:53

... according to 8 .2. 1 COPYRIGHT International Electrotechnical Commission Licensed by Information Handling Services STDmIEC 60 439 -2- ENGL ZOO0 = 4844871 0 727 8 96 O79 - 22 - 7.1.1 .6 60439 -2 CEI :20 00 O Elément ... Licensed by Information Handling Services - 388 .2. 10 .2. 1 60 439 -2 O CEI :20 00 L'essai décrit en 8 .2. 10.1.1 doit être exécuté avec une charge M=m+mL+QOkg 8 .2. 10 .2. 2 L'essai décrit en 8 .2. 10.1 .2 doit être ... Information Handling Services S T D - I E C b0439 -2- ENGL 20 00 - 4844873 0 727 933 T B B - 39- 60 439 -2 O IEC :20 00 8 .2. 10 .2. 1 The tests described in 8 .2. 10.1.1 shall be performed with the mass 8 .2. 10 .2. 2...

Ngày tải lên: 25/12/2013, 11:05

... Codes for VIN” Year 20 10 20 11 20 12 2013 20 14 20 15 20 16 20 17 20 18 20 19 20 20 20 21 20 22 2 023 20 24 20 25 20 26 20 27 20 28 49 CFR 565 .15(d)(1) - Table VII – Required Year Codes for VIN Code A B C D E F G ... Defects Investigations (20 2) 366 -5 322 Early Warning Division Telephone No./Link (20 2) 366 - 423 8 http://www-odi.nhtsa.dot.gov/ewr/ewr.cfm Office of Defects Investigation (20 2) 366 - 521 0 http://www-odi.nhtsa.dot.gov/ ... Division (20 2) 366 - 529 1 Questions about how to provide NHTSA with the manufacturer’s vehicle identification number deciphering information Import and Certification Division (20 2) 366 - 529 1 Questions...

Ngày tải lên: 07/03/2014, 11:20

... 55 1.5 (≤ 2. 3) 150 10 420 ND ND 700 3 .2 55 (4.5–5.5) 15 3.1 150 150 15 15 320 420 ND ND ND ND 700 700 2. 5 3 .2 55 55 3 .6 (3 .2 3.9) 5.0–7.0 12 15 75 21 0 ND ND 350 2. 0 28 2. 5–3.5 NOTE: AI = Adequate ... Levels for Assault Rations* 1,000 1,000 1,000 1,000 1,000 1,000 750–850 900 900 ND ND 1,800 1,500 900–1 ,60 0 18 10 15 14 24 8–18 420 320 420 320 420 320 400–550 55 55 55 55 55 55 55 23 0 11 15 12 15 ... of age [IOM, 20 01]); • Iron, 19.3 mg ( 16. 6 22 .9 mg), (MDRI = 10 for men [U.S Departments of the Army, Navy, and Air Force, 20 01]); • Magnesium, 341 mg (3 06 409 mg), (MDRI = 420 for men [U.S Departments...

Ngày tải lên: 14/03/2014, 10:20

... (1510–1545) GFP–MRP2 GFP–MRP2D7 GFP–MRP2D11 GFP–MRP2D15 GFP–MRP2D20 GFP–MRP2D25 GFP–MRP2D25 MAKE GFP–MRP2D50 GFP–MRP2D100 73 69 65 16 15 1 18 18 20 17 64 59 59 64 35 13 15 67 20 33 32 35 65 GKIIECGSPEELLQIPGPFYFMAKEAGIENVNSTKF ... jaundice in rats with a mutation in a Ó FEBS 20 02 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 multidrug resistance associated-protein gene Science 27 1, 1 1 26 – 1 127 Ito, K., Suzuki, H., Hirohashi, T., ... performed without butyrate induction Construct Time (days) % Apical % Vesicles % ER GFP–MRP2 4 70 81 77 71 2 21 11 55 47 54 47 78 69 69 63 11 12 22 36 45 38 47 20 28 29 35 GFP–MRP2D15 GFP–MRP2D25...

Ngày tải lên: 31/03/2014, 09:20

... version of this class is shown in Listing 6 -21 , and Listing 6 -22 shows the Visual Basic version Chapter 6: Building a Shopping Cart Application Listing 6 -21 : using using using using using using ... End Property 6 Public ReadOnly Property SubTotal() As Decimal Get ➝7 (continued) 21 1 21 2 Part III: Building E-Commerce Applications Listing 6 -20 (continued) Dim d As Decimal = 0D For Each item ... CartItem objects For a list of properties provided by the CartItem class, refer to Table 6- 6 Listings 6- 17 and 6- 18 present the C# and Visual Basic versions of this class 20 3 20 4 Part III: Building...

Ngày tải lên: 05/08/2014, 10:20

... base(msg, inner) {} } public class Device { Tip 120 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 Chapter 6: Statements and Exceptions ■ // Where an exception ... following example illustrates how to display different integer formats (views) 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 delegate void IntView(int c); class View { public static ... return subject; } private Subject subject; } 134 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 Chapter 7: Advanced Types, Polymorphism, and Accessors...

Ngày tải lên: 05/08/2014, 10:20

... 3080 68 .35 0 .69 0.70 3 320 66 . 32 0 .67 0 .68 3 560 64 .29 0 .65 0 .66 3800 62 . 26 0 .63 0 .64 4050 60 .23 0 .61 0. 62 4310 58 .20 0.59 0 .60 4580 3-47 Assumed Atmospheric Pressure Plus Gauge Pressure 2. 74 kPa ... 103.59 1 02. 58 101. 56 100.54 99.53 98.51 97.50 96. 48 95.47 94.45 92. 42 93.44 90.39 91.40 88. 36 89.37 86. 33 87.34 84 .29 85.31 82. 26 83 .28 80 .23 81 .25 78 .20 79 .22 76. 17 77.19 74.15 75.15 72. 12 73. 12 70.08 ... 0.90 121 0 86. 63 0.87 0.88 1400 84 .60 0.85 0. 86 1590 82. 57 0.83 0.84 1790 80.54 0.81 0. 82 2000 78.51 0.79 0.80 22 10 76. 48 0.77 0.78 24 20 74.45 0.75 0. 76 26 40 72. 41 0.73 0.74 28 60 70.38 0.71 0. 72 3080...

Ngày tải lên: 12/08/2014, 07:22

... 109 6. 1 Introduction 109 vi 6 .2 Experimental Section 1 12 6 .2. 1 Materials 1 12 6 .2. 2 Preparation of SPPO and Cross-linked PPO Membranes 1 12 6 .2. 3 Characterizations ... 2. 2 Direct Methanol Fuel Cells 2. 2.1 Construction and Basic Operations of DMFCs 2. 2 .2 Membrane Electrode Assembly 12 2 .2. 3 Proton Exchange Membranes 15 iv 2. 2.3.1 ... 65 4.1 Introduction 65 v 4 .2 Experimental Section 67 4 .2. 1 Materials 67 4 .2. 2 Preparation of SPPO/BPPO/α,ω-diamine SIPN Membranes 67 4 .2. 3 Characterizations...

Ngày tải lên: 09/09/2015, 10:14

... 23 2 A .2. 5 Statements 23 3 A .2. 6 Namespaces 23 5 A .2. 7 Classes 23 5 A .2. 8 Structs 23 7 A .2. 9 Arrays 23 7 A .2. 10 Interfaces 23 7 A .2. 11 Enums 23 8 A .2. 12 Delegates 23 8 A .2. 13 Attributes 23 8 Generics 23 8 ... Terminators 22 8 A.1 .2 White Space 22 8 A.1.3 Comments 22 8 A.1.4 Tokens 22 8 A.1.5 Unicode Character Escape Sequences A.1 .6 Identifiers 22 8 22 8 xiii xiv Contents ■ A .2 A.3 B A.1.7 Keywords 22 9 A.1.8 ... Assemblies 21 2 10 .2 Attributes 21 5 10 .2. 1 Using Attributes for Exception Serialization 21 6 10 .2. 2 Using Attributes for Conditional Compilation 21 7 10 .2. 3 Using Attributes for Obsolete Code 21 8 10 .2. 4...

Ngày tải lên: 20/08/2012, 11:57

... Err_xoa_Click Call xoarec Exit Sub Err_xoa_Click: MsgBox Err.Description End Sub 6/ Tạo Form Cập Nhật PTHU: Trang - mã lệnh nút form PTHU: Option Compare Database Private Sub dau_Click() On Error GoTo ... = True Exit Sub Err_dau_Click: MsgBox Err.Description Resume Exit_dau_Click End Sub Private Sub Form_Activate() DoCmd.Maximize End Sub Private Sub lui_Click() On Error GoTo Err_lui_Click Me.MSP.SetFocus ... Me.toi.Enabled = True Me.cuoi.Enabled = True Exit Sub Err_lui_Click: MsgBox "Da den mau tin dau tien", 64 , "Thong B¸o" Me.dau.Enabled = False Me.lui.Enabled = False End Sub Private Sub toi_Click() On...

Ngày tải lên: 04/09/2012, 10:16

Ngày tải lên: 04/10/2012, 09:39

... practice for the ducumentary credit 60 0) * ISBP 68 1 , 20 07- International standard banking practice * eUCP 1.1 , 20 07 - Suplement to UCP600 for presentation of electronic documents * URR 725 , ICC, 20 08 ... 000 000 , 00 (1  ,05 )   % 10 000 000 ,00 PA = 2. 760 .000,00 + 60 0.000,00 = 3. 360 .000 USD = 33 ,6% 9 /29 /20 10 ThS Nguyễn T Thanh Phương 50 25 ĐIỀU KIỆN VỀ THỜI GIAN THANH TOÁN TRẢ TIỀN NGAY ... Ban hành năm 19 56: Nguyên tắc nhờ thu chứng từ thương mại  lần sửa đổi năm 1 967 ; 1978 1995  Uniform Rules for the Collection – URC 522 , ICC, 1995 – Quy tắc thống nhờ thu URC 522 , ICC, 1995 Phòng...

Ngày tải lên: 05/12/2012, 00:03

... Add: P001 – E681 – 97 /24 – V n Cao – Ba ình – Hà N i FEATURES OF MASTERCMS E–ECOMMERCE EDITION 20 12 VER 2. 6 TÍNH N NG MASTERCMS E-COMMERCE ENTERPRISES EDITION 20 12 VERSION 2. 6 Tính n ng v th ng ... 97 /24 – V n Cao – Ba ình – Hà N i FEATURES OF MASTERCMS E–ECOMMERCE EDITION 20 12 VER 2. 6 Giao di n minh h a cách cài t m t chuyên m c cho s n ph m ©MasterCMS E-Commerce Edition 20 12 Ver 2. 6 A ... 97 /24 – V n Cao – Ba ình – Hà N i FEATURES OF MASTERCMS E–ECOMMERCE EDITION 20 12 VER 2. 6 t ki u hi n th tính n ng phía giao di n dành cho khách hàng ©MasterCMS E-Commerce Edition 20 12 Ver 2. 6...

Ngày tải lên: 30/01/2013, 16:17

... dốc: Trung bình năm Đất trống Đất có lớp phủ Ghi Đất (ha) 23 2 ,6 0 ,2 Nguồn: R Lal, 1977 Chảy (mm) 504,1 29 ,2 Độ dốc: 10% Chảy (%) 42, 1 2, 4 Nigeria Nguồn: Viện KHKT NLMN Phía Bắc + Vật liệu hữu ... Việt, 20 06 Tác dụng phân hữu chế biến từ rác thải sinh hoạt phế thải nông nghiệp đến sinh trưởng, phát triển suất đậu Tứ quý đất cát pha, tỉnh Quảng Bình Tạp chí Khoa học Đất, ISNN 0 868 -3743, 26 /20 06 ... Châu Thu Thân Thế Hùng, 20 08 Kết nghiên cứu phủ thảm hữu chống xói mòn đất đồi huyện Tam Nông, tỉnh Vĩnh Phú Tạp chí Khoa học Đất, ISNN 0 868 -3743, 29 /20 08 Phạm Văn Thành, 20 08 Hệ thống VAC Việt...

Ngày tải lên: 09/03/2013, 16:03