168 hp iccap modeling software user s guide hewlett

HBT characterization and modeling for nonlinear microwave circuit design

HBT characterization and modeling for nonlinear microwave circuit design

... devices There exist different types of heterostructures for HBTs, such as AlGaAs/GaAs, GaInP/GaAs in the GaAs-based HBTs, InP/InGaAs, InAlAs/InGaAs in InP-based 21 HBTs, Si/SiGe in Si-based HBTs ... progress on HBT modeling has been made during the past years, there are still many aspects in this research field which require further study such as the small-signal modeling and large-signal modeling ... being used in many system applications, such as direct broadcast by satellite (DBS), phase array radars, electronic warfare, global positioning system (GPS), wireless and optical communications 1.1.3...

Ngày tải lên: 17/09/2015, 17:20

212 746 0
Báo cáo khóa học: CD38 is expressed as noncovalently associated homodimers on the surface of murine B lymphocytes doc

Báo cáo khóa học: CD38 is expressed as noncovalently associated homodimers on the surface of murine B lymphocytes doc

... contrast, the surface half-life of CD38-lATG was less than half that observed for CD38 expressed by normal B cells or Ba/F3 transfectants, suggesting that this mutant protein is less stably expressed ... mutants expressed in Ba/F3 pro-B cells Each of the mutant CD38 cDNAs listed, was stably expressed in Ba/F3 cells (Materials and methods) or A20 cells as described previously [30] The cells were solubilized ... the plasma membrane was significantly less than wild-type CD38 resulting in reduced plasma membrane expression Thus, these results suggest that assembly of CD38 homodimers may influence the stable...

Ngày tải lên: 23/03/2014, 12:20

10 449 0
Báo cáo y học: "Asporin, a susceptibility gene in osteoarthritis, is expressed at higher levels in the more degenerate human intervertebral disc" ppsx

Báo cáo y học: "Asporin, a susceptibility gene in osteoarthritis, is expressed at higher levels in the more degenerate human intervertebral disc" ppsx

... individually embedded as mid-sagittal sections and also as en face sections individual discs Sections were processed as described below for immunohistochemical studies Expression of asporin in vivo and ... for the presence of asporin in lumbar discs of sand rats Gene expression studies showed greatest expression of asporin in the more degenerate human discs in vivo Asporin was also expressed in human ... weeks, and cultures terminated for harvest of mRNA and immunohistochemistry studies as described above Statistical analyses Standard statistical analyses were performed utilizing InStat (GraphPad...

Ngày tải lên: 09/08/2014, 14:20

7 235 0
The tumour-associated glycoprotein podoplanin is expressed in fibroblast-like synoviocytes of the pdf

The tumour-associated glycoprotein podoplanin is expressed in fibroblast-like synoviocytes of the pdf

... expression in human synovial tissue from 18 RA patients and nine osteoarthritis (OA) patients was assessed by immunohistochemistry and confirmed by Western blot analysis The expression was related ... developmental processes, tissue repair, fibrosis and carcinogenesis [24,25] Recently, it was also suggested that migrating RA-FLSs might be responsible for spreading the disease to distant joints [26] Podoplanin ... both OA-FLSs and RA-FLSs express a-sma by passage About 60% (58.2% for RA-FLSs and 61.7% for OA-FLSs) were double-positive for podoplanin and a-sma All podoplaninpositive cells expressed a-sma (Figure...

Ngày tải lên: 12/08/2014, 15:22

12 269 0
Báo cáo y học: "Elevated plasma homocysteine is positively associated with age independent of C677T mutation of the methylenetetrahydrofolate reductase gene in selected Egyptian subjects"

Báo cáo y học: "Elevated plasma homocysteine is positively associated with age independent of C677T mutation of the methylenetetrahydrofolate reductase gene in selected Egyptian subjects"

... case/control status, and random samples of cases and controls were tested twice by different persons, and the results were concordant for all masked cases Statistical analysis: The distributions of plasma ... considered statistically significant Statistical analysis was performed using SPSS 10 statistical Package Results The results of some clinical data and biochemical results of the different groups included ... most studies did not show an association between the MTHFR mutation and subsequent development of cardiovascular diseases [23,24,54] Our results are in keeping with the results of these studies...

Ngày tải lên: 03/11/2012, 09:49

12 519 0
Tài liệu Báo cáo khoa học: Octaketide-producing type III polyketide synthase from Hypericum perforatum is expressed in dark glands accumulating hypericins pdf

Tài liệu Báo cáo khoa học: Octaketide-producing type III polyketide synthase from Hypericum perforatum is expressed in dark glands accumulating hypericins pdf

... type III PKSs grouped into CHSs and non-CHSs, except stilbene synthases (STSs) from Fabaceae and Gymnosperms In these cases, the STSs were closer to CHSs of the same or related species than other ... acid substitutions per site The GenBank accession numbers are followed by the names of the species ACS, acridone synthase; ALS, aloesone synthase; BAS, benzalacetone synthase; BBS, bibenzyl synthase; ... encoding for PKSs, designated as HpPKS1 and HpPKS2 [25] Expression of HpPKS2 was found to correlate with the concentration of hypericins in H perforatum tissues and HpPKS2 is thus a candidate...

Ngày tải lên: 18/02/2014, 18:20

14 451 0
Báo cáo khoa học: SAF-3, a novel splice variant of the SAF-1/MAZ/Pur-1 family, is expressed during inflammation pptx

Báo cáo khoa học: SAF-3, a novel splice variant of the SAF-1/MAZ/Pur-1 family, is expressed during inflammation pptx

... these cells was subjected to reverse transcription followed by nested PCR amplification to monitor SAF-3 expression The same sets of RNAs were also used to monitor MMP-9 and GAPDH expression, as ... cytokine-responsive expression of SAF-3, we examined its level in diseased tissues Osteoarthritis (OA) is a chronic inflammatory disease that involves degeneration of the cartilage tissue, while ... tissues, but very little to no SAF-3 mRNA expression was detected in normal synovium (Fig 4, lanes and 2) SAF-1 expression was detected in normal tissues and was slightly elevated in both disease...

Ngày tải lên: 07/03/2014, 02:20

11 439 0
Báo cáo khoa học: Neuroserpin Portland (Ser52Arg) is trapped as an inactive intermediate that rapidly forms polymers Implications for the epilepsy seen in the dementia FENIB ppt

Báo cáo khoa học: Neuroserpin Portland (Ser52Arg) is trapped as an inactive intermediate that rapidly forms polymers Implications for the epilepsy seen in the dementia FENIB ppt

... neuroserpin assessed by emission maxima of intrinsic tryptophan fluorescence The unfolding pattern of wild-type neuroserpin was also assessed by the CD ellipticity at 222 nm and superimposed (·) ... transverse urea gradient PAGE, and activity was assessed against tPA [6] Complex formation assays Wild-type and Ser52Arg neuroserpin were incubated in various ratios with tPA at 25 °C as described ... incubation times The profiles obtained for wild-type neuroserpin, Ser49Pro and Ser52Arg were consistent with the results obtained from both transverse urea gradient gels and assessment of the melting...

Ngày tải lên: 07/03/2014, 16:20

8 495 0
Báo cáo khoa học: Molecular characterization of a novel nuclear transglutaminase that is expressed during starfish embryogenesis ppt

Báo cáo khoa học: Molecular characterization of a novel nuclear transglutaminase that is expressed during starfish embryogenesis ppt

... lHem nTG hKer hPro LVVNFECDKLKAVKGYRNVIIGPA LMVDFESDKLTGVKGYRNVIIAPLPK IVATFSSRQLIQVVGSKQVEVLD LIVSFSSPQLSGVKAHVTLNVKSA LIASLDSPQLSQVHGVIQVDVAPAPGDGGFFSDAGGDSHLGETIPMASRGGA FIVKLSSKQVKEINAQKIVLITK ... -SSFVLGHFILLYNPRCPADAVYMDSDQERQEYVLTQQGFIYQGSAKFINGIPWN SAVLQQQDGATLCVSLCSPSIARVGRYRLTLEASTGYQG -SSFHLGDFVLLFNAWHPEDAVYLKEEDERREYVLSQQGLIYMGSRDYITSTPWN DVRLRQHDGAVITLEIQIPAAVAVGVWKMKIVSQLTSEEQPNVSAVTHECKNKTYILFNPWCKQDSVYMEDEQWRKEYVLSDVGKIFTGSFKQPVGRRWI ... -DGSLRKSIN-HLVVGLKISTKSVGRDE REDITHTYKYPEGSEEEREAFVRANHLNKLATKEKEGDLQVQYDIPFVFAEVNADVVYWIVQS -DGEKKKSTH-SSVVGKNISTKSVGRDS REDITHTYKYPEGSEKEREVFSKAEHEKSSLG QRGEIGYMFDSPFVFSEVNADVVHWQEDDSS-ETGYKKLKIDSYRVGRLLLTKKIGVDDDFGDADAEDITDQYKNKEGTDEERMSVLNAARSSGFNYAFN...

Ngày tải lên: 08/03/2014, 10:20

11 502 0
Growth kinetics of silicon nanowires by platinum assisted vapour–liquid–solid mechanism

Growth kinetics of silicon nanowires by platinum assisted vapour–liquid–solid mechanism

... Chemical Physics Letters 467 (2009) 331–334 Fig Synthesis of Si nanowires using Au and Pt as catalysts (a) Vertically-aligned Si nanowires using Au (b) Vertically-aligned Si nanowires using Pt Si nanowires ... nanowires are single crystalline, without any structural defects Alloy globules of Pt–Si or Au–Si were formed at the tips of the nanowires An energy dispersive spectroscopy (EDS) analysis across the ... of a CMOS compatible Si nanowire growth process using Pt as a VLS catalyst is potentially a fruitful direction for future research Summary Si nanowires were successfully synthesized using Au...

Ngày tải lên: 16/03/2014, 15:05

4 432 0
Oriented silicon nanowires on silicon substrates from oxide assisted growth and gold catalysts

Oriented silicon nanowires on silicon substrates from oxide assisted growth and gold catalysts

... image (Fig 4a) shows the as-grown SiNWs consist of a crystalline core and an amorphous silicon oxide sheath, similar to the SiNWs grown by the OAG method without Au catalyst As illustrated in Fig ... defects The high-quality epitaxy at the interface is expected to subsequently guide the oriented growth of SiNWs on the Si substrate The growth process of SiNWs can be described as follows [8]: ... temperature is dependent on the metal catalyst As Au and Si can form an eutectic alloy as low as 363 °C [9], consequently SiNWs have been synthesized under 500 °C using Au as the catalyst and SiH4 as the...

Ngày tải lên: 16/03/2014, 15:06

5 539 0
Báo cáo khoa học: A novel serine protease highly expressed in the pancreas is expressed in various kinds of cancer cells potx

Báo cáo khoa học: A novel serine protease highly expressed in the pancreas is expressed in various kinds of cancer cells potx

... A novel serine protease in various cancer cells serine protease, spinesin ⁄ TMPRSS5, which is localized at synapses [6] Motopsin (PRSS12) is a mosaic serine protease, with a kringle ... expression of prosemin in ovarian cancer cell lines Ovarian cancers express some kinds of chromosome 16 serine proteases, including testisin and prostasin We investigated the expression of prosemin ... chromosome 16 protease family members, the prosemin gene structure is similar to the structures of prostasin, c-tryptase, and testisin The characteristic feature of these genes is the short second...

Ngày tải lên: 16/03/2014, 23:20

13 483 0
Báo cáo Y học: Group IID heparin-binding secretory phospholipase A2 is expressed in human colon carcinoma cells and human mast cells and up-regulated in mouse inflammatory tissues doc

Báo cáo Y học: Group IID heparin-binding secretory phospholipase A2 is expressed in human colon carcinoma cells and human mast cells and up-regulated in mouse inflammatory tissues doc

... allergic diseases It should be noted, however, that this finding does not necessarily mean that all mast cells distributed in human tissues express sPLA2IID only, since mast cell phenotypes is crucially ... Previous studies have established that mast cells represent a potent source of sPLA 2s; mouse IL-3-dependent bone marrow-derived mast cells express all or some of the group II subfamily sPLA 2s according ... located in mast cells in tissues from patients with allergic symptoms (M Murakami & I Kudo, unpublished data) Increased expression of sPLA2-IID was observed in some tissues (lung, thymus and heart)...

Ngày tải lên: 18/03/2014, 01:20

10 334 0
Báo cáo khoa học: Expressed as the sole Hsp90 of yeast, the a and b isoforms of human Hsp90 differ with regard to their capacities for activation of certain client proteins, whereas only Hsp90b generates sensitivity to the Hsp90 inhibitor radicicol pdf

Báo cáo khoa học: Expressed as the sole Hsp90 of yeast, the a and b isoforms of human Hsp90 differ with regard to their capacities for activation of certain client proteins, whereas only Hsp90b generates sensitivity to the Hsp90 inhibitor radicicol pdf

... Hsp90a and Hsp90b expressed in yeast S H Millson et al duplication of the S cerevisiae genome [8], as most yeast species have just a single Hsp90 Vertebrates also have two major forms of cytosolic ... leading to a strain (PP30[hHsp90a]) that expresses human Hsp90a as its sole Hsp90 Determination of client activations Measurements of HSE2-LacZ expression, GR expression and v-src expression were ... only expression of Hsp90b, not comparable expression of Hsp90a, which renders yeast highly sensitive to radicicol (Fig 6) This raises the distinct possibility that, in mammalian systems as well,...

Ngày tải lên: 23/03/2014, 07:20

11 427 0
Báo cáo khoa học: Biosynthesis of platelet glycoprotein V expressed as a single subunit or in association with GPIb-IX doc

Báo cáo khoa học: Biosynthesis of platelet glycoprotein V expressed as a single subunit or in association with GPIb-IX doc

... into its structural and functional role in platelets To address these questions, we have developed two heterologous expression cell systems where GPV was transfected in the presence or absence ... human K562 cells This cell line was chosen for biosynthetic studies in order to analyse the processing of GPV in a cell system more closely resembling platelets Pulse–chase experiments performed ... cell systems The relevance of these findings for platelet biosynthesis is unknown It is nevertheless clear that mice deficient in GPV express normal levels of GPIb–IX on the surface of platelets, suggesting...

Ngày tải lên: 23/03/2014, 13:20

7 364 0
Báo cáo khoa học: NARG2 encodes a novel nuclear protein with (S/T)PXX motifs that is expressed during development docx

Báo cáo khoa học: NARG2 encodes a novel nuclear protein with (S/T)PXX motifs that is expressed during development docx

... identification of conserved GT:AG nucleotides of intron splice sites Synonymous and nonsynonymous substitution rates between the human and mouse NARG2 cDNAs, as well as insertions and deletions, were calculated ... human tissues Previous studies in mice demonstrated that, in the brain, NARG2 is expressed at the highest levels in neonates, and is subsequently down-regulated [11] In the adult mouse, NARG2 is expressed ... deletions in exon 10 Cumulative indexes of synonymous nucleotide substitutions and nonsynonymous substitutions per codon, and insertions and deletions are plotted vs the NARG2 amino acid sequence, starting...

Ngày tải lên: 23/03/2014, 13:20

9 470 0
Báo cáo Y học: A new siglec family member, siglec-10, is expressed in cells of the immune system and has signaling properties similar to CD33 docx

Báo cáo Y học: A new siglec family member, siglec-10, is expressed in cells of the immune system and has signaling properties similar to CD33 docx

... kinases whereas phosphorylation of ITIM motif tyrosines would allow for recruitment of phosphatases SHIP, SHP-1 or SHP-2 Siglec-3/CD33 contains two tyrosines that recruit SHP-1 and SHP-2 upon phosphorylation ... and Geimsa stains Results were expressed as the percentage of COS7 cell binding and all binding to transfected cells was compared to sham transfected controls Results shown are means ^ SD of two ... for mRNA integrity and loading washed and then twofold dilutions of the GST fusion proteins, GST alone, GST– SHP-1SH2SH2 or GST–SHP2SH2SH2 or GST – ZAP-70SH2SH2 were added and incubated for h...

Ngày tải lên: 24/03/2014, 04:21

14 541 0
Báo cáo khoa học: Prohibitin is expressed in pancreatic b-cells and protects against oxidative and proapoptotic effects of ethanol pdf

Báo cáo khoa học: Prohibitin is expressed in pancreatic b-cells and protects against oxidative and proapoptotic effects of ethanol pdf

... PHB siRNA Discussion Here we report for the first time that PHB is expressed in pancreatic b-cells and may protect these cells against oxidative stress and apoptosis We induced oxidative stress ... phosphorylation, which is the source of ROS, at glucose concentrations significantly greater than 5.5 mm in these cells Although PHB is known to be expressed in many tissues, this is the first ... b-cells and increases with oxidative stress induced by ethanol exposure, possibly to protect b-cells against oxidative and proapoptotic effects of this drug If PHB protects against oxidative stress...

Ngày tải lên: 29/03/2014, 08:20

13 447 0
báo cáo hóa học:" Serum high mobility group box-1 (HMGB1) is closely associated with the clinical and pathologic features of gastric cancer" pptx

báo cáo hóa học:" Serum high mobility group box-1 (HMGB1) is closely associated with the clinical and pathologic features of gastric cancer" pptx

... over-expression of HMGB1 in GC is reported to be associated with tumor invasiveness and metastasis [1517] In almost all of these studies, the over-expression of HMGB1 has been documented in tissues by ... data support and analysis and pvalues < 0.05 were considered as statistically significant differences Results Characteristics of the subjects The 227 subjects studied included 50 patients with ... activity in tissue requires invasive techniques such as endoscopy and biopsy, that are associated with patient discomfort and risk HMGB1 could be measured in serum and used as a serologic tumor...

Ngày tải lên: 18/06/2014, 15:20

11 536 0
báo cáo hóa học:" Sperm protein 17 is expressed in the sperm fibrous sheath" ppt

báo cáo hóa học:" Sperm protein 17 is expressed in the sperm fibrous sheath" ppt

... immunohistochemical studies showed that Sp17 is expressed not only in germinal tissues, but also in the human respiratory airways and reproductive systems, and in particular in ciliated cells [15] ... tumor tissues and cells [10-12,29] A possible role of Sp17 was demonstrated in transformed lymphoid and hematopoietic cells [8], suggesting that Sp17 may be involved in tumorigenesis mechanisms by ... microscopy (Leica DMLA, Milan, Italy) and the number of those immunopositive for Sp17 was expressed as the mean percent ± SD of all spermatozoa Samples The study, using human subjects, was carried...

Ngày tải lên: 18/06/2014, 15:20

5 435 0
w