Thông tin tài liệu
Retrovirology BioMed Central Open Access Research Phosphorylation of HIV-1 Tat by CDK2 in HIV-1 transcription Tatyana Ammosova1, Reem Berro4, Marina Jerebtsova5, Angela Jackson2, Sharroya Charles3, Zachary Klase4, William Southerland2, Victor R Gordeuk1, Fatah Kashanchi4 and Sergei Nekhai*1,2,4 Address: 1Center for Sickle Cell Disease, Howard University College of Medicine, 520 W Street N.W., Washington, DC 20059, USA, 2Department of Biochemistry and Molecular Biology, Howard University College of Medicine, 520 W Street N.W., Washington, DC 20059, USA, 3Program in Genetics, Howard University College of Medicine, 520 W Street N.W., Washington, DC 20059, USA, 4Department of Biochemistry and Molecular Biology, The George Washington University Medical Center, 2300 I Street N.W., Washington, DC 20037, USA and 5Children's National Medical Center, CRI Center III, 111 Michigan Ave., N.W Washington, D.C 20010-2970, USA Email: Tatyana Ammosova - tammosova@mail.ru; Reem Berro - ramroom@gmail.com; Marina Jerebtsova - mjerebts@cnmc.org; Angela Jackson - comptona99@hotmail.com; Sharroya Charles - sho2roya@yahoo.com; Zachary Klase - zklase@gwu.edu; William Southerland - wsoutherland@howard.edu; Victor R Gordeuk - vgoreduk@howard.edu; Fatah Kashanchi - bcmfxk@gwumc.edu; Sergei Nekhai* - snekhai@howard.edu * Corresponding author Published: 03 November 2006 Retrovirology 2006, 3:78 doi:10.1186/1742-4690-3-78 Received: 27 July 2006 Accepted: 03 November 2006 This article is available from: http://www.retrovirology.com/content/3/1/78 © 2006 Ammosova et al; licensee BioMed Central Ltd This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited Abstract Background: Transcription of HIV-1 genes is activated by HIV-1 Tat protein, which induces phosphorylation of RNA polymerase II (RNAPII) C-terminal domain (CTD) by CDK9/cyclin T1 Earlier we showed that CDK2/cyclin E phosphorylates HIV-1 Tat in vitro We also showed that CDK2 induces HIV-1 transcription in vitro and that inhibition of CDK2 expression by RNA interference inhibits HIV-1 transcription and viral replication in cultured cells In the present study, we analyzed whether Tat is phosphorylated in cultured cells by CDK2 and whether Tat phosphorylation has a regulatory effect on HIV-1 transcription Results: We analyzed HIV-1 Tat phosphorylation by CDK2 in vitro and identified Ser16 and Ser46 residues of Tat as potential phosphorylation sites Tat was phosphorylated in HeLa cells infected with Tat-expressing adenovirus and metabolically labeled with 32P CDK2-specific siRNA reduced the amount and the activity of cellular CDK2 and significantly decreased phosphorylation of Tat Tat co-migrated with CDK2 on glycerol gradient and co-immunoprecipitated with CDK2 from the cellular extracts Tat was phosphorylated on serine residues in vivo, and mutations of Ser16 and Ser46 residues of Tat reduced Tat phosphorylation in vivo Mutation of Ser16 and Ser46 residues of Tat reduced HIV-1 transcription in transiently transfected cells The mutations of Tat also inhibited HIV-1 viral replication and Tat phosphorylation in the context of the integrated HIV-1 provirus Analysis of physiological importance of the S16QP(K/R)19 and S46YGR49 sequences of Tat showed that Ser16 and Ser46 and R49 residues are highly conserved whereas mutation of the (K/R)19 residue correlated with non-progression of HIV-1 disease Conclusion: Our results indicate for the first time that Tat is phosphorylated in vivo; Tat phosphorylation is likely to be mediated by CDK2; and phosphorylation of Tat is important for HIV-1 transcription Page of 21 (page number not for citation purposes) Retrovirology 2006, 3:78 Background The human immunodeficiency virus type (HIV-1) requires host cell factors for all steps of the viral replication [1,2] Recently, multiple covalent modifications of viral proteins that regulate virus-host protein interactions have been described, such as phosphorylation, acetylation and ubiquitination Phosphorylation has been reported for almost all HIV-1 accessory proteins, including Vpu [3], Vpr [4], Vif [5], Nef [6], and Rev [7] Transcription of HIV1 viral genes is induced by a viral transactivator protein (Tat) [1,2] The activation domain of Tat (amino acids 1– 48) interacts with host cell factors, whereas the positively charged RNA-binding domain (amino acids 49–57) interacts with HIV-1 transactivation response (TAR) RNA [1,2] In cell-free transcription assays Tat induces exclusively elongation of transcription [8,9] In vivo, Tat additionally induces initiation of transcription from the integrated HIV-1 promoter [10-12] Tat stimulates formation of transcription complex containing TATA-box-binding protein (TBP) but not TBP-associated factors (TAFs), thus indicating that Tat may enhance initiation of transcription [10], apparently in agreement with the earlier observation that Tat binds directly to the TBP-containing basal transcription factor TFIID [13] Tat activates HIV-1 transcription by recruiting transcriptional co-activators that include Positive Transcription Elongation Factor b (P-TEFb), containing CDK9/cyclin T1; an RNA polymerase II C-terminal domain kinase [9,14,15] and histone acetyl transferases [16-18] Whereas P-TEFb induces HIV-1 transcription from non-integrated HIV-1 template [9,14,15], histone acetyl transferases allow induction of integrated HIV-1 provirus [16-18] Additional CTD kinases, including CDK2 and CDK7 were also reported to be activated by Tat and to induce functional CTD phosphorylation [19,20] Tat itself is a subject for covalent modifications by host cell proteins Tat is directly acetylated at lysine 28, within the activation domain, and lysine 50, in the TAR RNA binding domain [21] Tat is also ubiquitinated at lysine 71 and its ubiquitination stimulates the transcriptional properties of Tat [22] Recently, Tat was shown to be methylated by the arginine methyltransferase, PRMT6 and the arginine methylation of Tat negatively regulated its transcriptional activity [23] Surprisingly, in spite of the interaction of Tat with P-TEFb and probably other kinases and its involvement in multiple protein phosphorylation reactions, the phosphorylation of HIV-1 Tat has only been reported in vitro [24], but not in vivo [25] HIV-2 Tat was reported to be phosphorylated in vivo presumably by CDK9, but this phosphorylation was not important for Tat-2 function as a transcriptional activator [26] We previously reported that Tat dynamically interacts with CDK2/cyclin E and is also phosphorylated by CDK2/cyclin E in vitro [20] This dynamic interaction greatly stimulated the activity of CDK2/cyclin E toward phosphorylation of CTD in vitro [20] In the present study http://www.retrovirology.com/content/3/1/78 we investigated whether Tat is phosphorylated in vivo and whether this phosphorylation has a regulatory role in Tatactivated HIV-1 transcription Results Tat is phosphorylated by CDK2 in vitro and Ser-16 and Ser-46 residues of Tat are potential phosphorylation sites We previously showed that Tat is phosphorylated by recombinant CDK2/cyclin E in vitro and that Tat's Ser16 was a potential phosphorylation site [20] Indeed recombinant CDK2/cyclin E efficiently phosphorylates Tat (Fig 1A, lane 1) Tat can also be phosphorylated by HeLa nuclear extract (Fig 1A, lane 2) Immunodepletion of CDK2 from HeLa nuclear extract completely abolished Tat phosphorylation (Fig 1A, lane 3) suggesting that under these conditions Tat was largely phosphorylated by CDK2 Upon analysis of the sequence of Tat, the (S/ T)0P1K2(K/R)3 consensus motif for serine phosphorylation by CDK2 [27,28] was not found, but several sequences were found that partially matched this motif: S16QP(K/R)19 , S46YGR49 , S68LSK71 To determine potential phosphorylation sites, Tat phosphorylated in vitro was analyzed by Mass spectrometry For this purpose, purified recombinant Tat was phosphorylated with recombinant CDK2/cyclin E in vitro followed by immunoprecipitation, SDS-PAGE purification, in-gel digestion with trypsin, and HPLC purification Analysis of HPLC eluates showed presence of two peaks in the digest generated from phosphorylated Tat that were absent in digest of nonphosphorylated Tat (Fig 1B) These two peaks were collected and subjected to MALDI-TOF mass spectrometry Masses of the peptides over 900 Da were acquired and analyzed with FindPep tool [29] using the sequence of Tat (MEPVDPNLEPWKHPGSQPRTACNNCYCKKCCFHCYA CFTRKGLGISYGRKKRRQRRRAPQDSQTHQASLSKQ) as input The masses of peptides that did not match to Tat were further compared with Tat peptides from which we subtracted 18 Da, assuming β-elimination of phosphoric acid which is likely to occur during MALDI-TOF analysis [30] Matched peptides shown in Table 1, indicate that Peak I contains peptides with Serine 46 as a potential phosphorylation site, whereas Peak II contains peptides with Serine 16 as a potential phosphorylation site All matched peptides contain internal lysine or arginine residues, and thus they are apparently products of incomplete digestion by trypsin, which could be a result of incomplete in-gel digestion Also acquisition of peptide with masses over 900 Da would only allow detection of relatively large peptides The data suggest that Tat is phosphorylated in vitro by CDK2 and that this phosphorylation might take place at Ser16 or Ser46 residues within S16QPR19 and S46YGR49 sequences that partially match to the (S/ T)P×(K/R) consensus sequence for CDK2 phosphorylation [28] Page of 21 (page number not for citation purposes) Retrovirology 2006, 3:78 http://www.retrovirology.com/content/3/1/78 Table 1: Determination of sites of phosphorylation in Tat Peak -18Da Matching peptides (T)RKGLGISYG(R) 950.606 932.606 1220.7 1202.7 (S)YGRKKRRQRR/(R) 1403.779 1385.779 932.606 931.553 1202.7 1202.698 1385.779 1385.777 (L)EPWKHPGSQPRTACNNCYCK/(K) 2319.272 2301.272 (P)WKHPGSQPRTAC(N) 1367.563 1349.563 (P)WKHPGSQPRTACNN(C) 1595.811 1577.811 (P)NLEPWKHPG(S) II MW (L)GISYGRKKRR/(Q) I Peptides matching to Tat 1077.606 1059.606 Tat is phosphorylated in cultured cells Previous attempts to detect Tat phosphorylation in vivo were unsuccessful [25] We hypothesized that low level of Tat expression after transfection and/or rapid de-phosphorylation by cellular phosphatases might prevent detection of Tat phosphorylation in vivo To overcome these difficulties, we expressed Flag-tagged Tat which we found to be expressed to a higher level in COS-7 cells than untagged Tat (Fig 2, compare lanes and 4) To facilitate expression of Flag-Tat in HeLa cells we used adenovirusmediated expression of Tat [31] HeLa cells were infected with Adeno-Tat and incubated 48 hours post infection to allow expression of Tat Then cells were pulsed with (32P)labeled orthophosphate, and Tat was immunoprecipitated from cellular lysates using monoclonal anti-Flag or polyclonal anti-Tat antibodies Immunoprecipitated proteins were resolved by SDS-PAGE on 15% Tris-Tricine gel [32] and transferred to PVDF membrane The membrane was probed with monoclonal anti-Tat antibodies (Fig 3A) using 3,3'-Diaminobenzidine enhancer system (DABM, Sigma), and also exposed to a PhosphoImager screen (Fig 3B) Both antibodies precipitated a well detectable amount of Tat protein (Fig 3A, lanes 3, 4, and 7) Under these experimental conditions, Tat was phosphorylated (Figs 3B and 3C, compare lane to lane and lane to lane 5) Next we treated cells with okadaic acid, an inhibitor of PPP-type phosphatases, to prevent rapid dephosphorylation of Tat in the cells and during the lysis procedure Treatment with okadaic acid did not change the amount of precipitated Tat (Fig 3A, lanes 3, 4, and 7) In contrast, Tat phosphorylation was significantly enhanced when cells were treated with okadaic acid (Figs.3B and 3C, lanes and 7) Taken together, these results indicate that Tat is phosphorylated in vivo and that Tat phosphorylation is enhanced when cells are treated with the inhibitor of PPP-phosphatases 2301.272 2301.274 1349.563 1349.544 1349.563 1349.544 1577.811, 1576.779 1059.606 CDK2 phosphorylates Tat in cultured cells We next investigated whether Tat phosphorylation was mediated by CDK2 in vivo using CDK2-directed RNA interference [33] HeLa cells were infected with Adeno-Tat and subsequently transfected with siRNAs against CDK2 Transfection of HeLa cells with siRNAs against CDK2 decreased the level of expression of CDK2 by 2.5-fold (Figs 4A and 4B, lane 3) A control non-targeting siRNA pool did not affect expression of CDK2 (Figs 4A and 4B, lane 2) The non-targeting siRNA control was used to ensure that transfection itself did not affect CDK2 expression Western blot analysis of tubulin and CDK9 was used as control for the specificity of siRNAs As shown in Fig 4A transfection with both siRNAs did not affect the level of α-tubulin expression To ensure that CDK2-directed siRNA decreased the enzymatic activity of cellular CDK2, CDK2 was immunoprecipitated from cells transfected with non-targeting or CDK2-directed siRNA and assayed for its enzymatic activity using recombinant Tat as a substrate The activity of CDK2 was decreased in the cells transfected with CDK2-directed siRNA (Fig 4C, lane 2) as compared to the cells transfected with non-targeting siRNA (Fig 4C, lane 1) Next the cells were infected with Adeno-Tat, transfected with non-targeting or CDK2directed siRNAs and pulse-labeled with (32P) In this experiment no okadaic acid was used Inhibition of CDK2 by siRNA reduced the level of Tat phosphorylation by 3fold (Figs 5A,B and 5C, compare lanes and 3) Thus CDK2 is likely to mediate Tat phosphorylation in cultured cells To analyze whether Tat and CDK2 might be present in the same molecular weight complex, we analyzed sedimentation of Tat and CDK2 by ultracentrifugation on a glycerol gradient (Fig 6) Both Tat and CDK2 co-migrated in fractions 1–8 (Fig 6) The CDK9 was present in most of the fractions with the peak in fractions 4–5 and 9–10 (Fig 6), which is likely to correspond to low and high molecu- Page of 21 (page number not for citation purposes) Retrovirology 2006, 3:78 A http://www.retrovirology.com/content/3/1/78 CDK2/cyclin E HeLa NE CDK2 depleted NE Coomassie + + + MW 13 9- Tat (32P) Tat B no Tat Tat (Phospho)Tat I II Analysis HIV-1 Tat phosphorylated by CDK2/cyclin E in vitro Figure of Analysis of HIV-1 Tat phosphorylated by CDK2/cyclin E in vitro A, Tat is phosphorylated by CDK2 Recombinant Tat was phosphorylated in vitro by purified CDK2/cyclin E (lane 1), by HeLa nuclear extract (lane 2) or by CDK2-depleted HeLa nuclear extract (lane 3) Tat was resolved by 12% SDS Tris-Tricin PAGE The gel was stained with Coomassie blue (upper panel) and exposed to Phospho Imager screen (lower panel) B, HPLC profiles of Tat peptides after trypsin cleavage Recombinant Tat was phosphorylated in vitro by purified CDK2/cyclin E, resolved by 12% SDS Tris-Tricin PAGE, and subjected to in-gel trypsin digestion The eluted peptides were resolved by reverse phase chromatography on μRPC C2/C18 ST 4.6/100 column No Tat, mock trypsin digest without Tat Tat, digest of non-phosphorylated Tat (Phospho)-Tat, digestion of phosphorylated Tat I and II, peaks identified in the elution profile of phosphorylated Tat that were subjected to MALDI TOF/ TOF mass spectrometry Page of 21 (page number not for citation purposes) Retrovirology 2006, 3:78 http://www.retrovirology.com/content/3/1/78 MW - Tat FlagTat kDa 111 80 61 49 36 25 19 13 - Flag-Tat Tat 9- Figure Expression of untagged and Flag-tagged Tat Expression of untagged and Flag-tagged Tat COS-7 cells were transfected with Tat (lane 3) and Flag-tagged Tat (lane 4) expression vectors or mock-transfected (lane 2) At 48 hours post transfection cells were lysed and Tat was immediately immunoprecipitated with anti-Tat rabbit polyclonal antibodies (lanes 2–4) Immunoprecipitated Tat was resolved by 15% TrisTricine SDS-PAGE, transferred to polyvinylidene fluoride membrane and immunoblotted with anti-Tat monoclonal antibodies using the 3,3'-diaminobenzidine enhancer system Positions of Tat and Flag-Tat are indicated Lane 1, prestained 10 kDa molecular weight markers Page of 21 (page number not for citation purposes) Retrovirology 2006, 3:78 http://www.retrovirology.com/content/3/1/78 A IP: Tat Flag-Tat OA Western IP: Flag - - + + - + - + - + + + - + kDa 37 - * 25 19 - Tat B Tat (32P) (32P) Tat, Arbitrary Units C 50 40 30 20 10 45 31 14 0.3 6 Figure HIV-1 Tat is phosphorylated in cultured cells HIV-1 Tat is phosphorylated in cultured cells HeLa cells were infected with recombinant adenovirus expressing Flagtagged Tat as described in Methods (lanes 3, 4, and 7) Lanes 1, 2, and – control uninfected cells At 48 hours post infection cells were labeled with (32P)-orthophosphate for hours without (lanes 1, and 6) or with (lanes 2, 4, and 7) μM okadaic acid (OA) Whole cell extracts were prepared and Tat was immunoprecipitated with anti-Tat rabbit polyclonal antibodies (lanes 1–4) or anti-Flag monoclonal murine antibodies (lanes 5–7) Immunoprecipitated Tat was resolved by 15% Tris-Tricine SDS-PAGE, and transferred to polyvinylidene fluoride membrane A, immunoblot of the membrane with anti-Tat monoclonal antibodies using the 3,3'-diaminobenzidine enhancer system B, autoradiography of the membrane on Phosphor Imager C, quantification of panel B The position of light chain of IgG recognized in anti-Flag immunoprecipitates by anti-mouse HRP-conjugated secondary antibodies is indicated by asterisk Page of 21 (page number not for citation purposes) Retrovirology 2006, 3:78 lar weight P-TEFb complexes HEXIM1, and Brd4 were mostly present in fractions 2–6, although HEXIM1 was also detected in higher molecular weight fractions 10 and 11 (Fig 6) Neither Tat nor CDK2 co-migrated with RNAPII which was present in fractions 1–13 (Fig 6) We further analyzed association of Tat with CDK2 by immunoprecipitation Flag-Tat was expressed in HeLa cells by infection with Adeno-Tat and precipitated from cellular extracts with anti-Flag antibodies (Fig 7A) CDK2 co-precipitated with Tat (Fig 7A, lane 4) CDK2 was not precipitated with anti-Tat antiserum from non-infected cells (Fig 7A, lane 3) or not with non-specific preimmune serum from adeno-Tat infected cells (Fig 7A, lane 5) Inhibition of CDK2 expression by CDK2-specific RNAi significantly reduced CDK2 co-precipitated to Tat apparently due reduction of the expressed CDK2 (Fig 7B, compare lane to lane 2) Association of Tat with CDK9 was slightly reduced (Fig 6B) but this reduction correlated to the decreased amount of Tat precipitated by anti-Flag antibodies Binding of Tat-cyclin T1 was not reduced (Fig 7C, lanes and 5) The cyclin T2 did not precipitate with Tat (Fig 7C), which indicated a specificity of the immunoprecipitation Taking together, these results suggest that CDK2 associates with Tat in cultured cells, and that inhibition of CDK2 expression prevents Tat phosphorylation Thus, CDK2 is likely to phosphorylate Tat directly in cultured cells Tat is phosphorylated on serine residues in vivo We next determined whether serine, threonine or tyrosine residues of Tat were phosphorylated in vivo HeLa cells were infected with Adeno-Tat, labeled with (32P), and treated with okadaic acid to achieve a higher level of Tat phosphorylation Tat was immunoprecipitated with antiFlag antibody and resolved on 15% SDS Tris-Tricine PAGE (Fig 8A, lane 1) Phosphoamino acid analysis of radioactive Tat extracted from the gel (see Materials and Methods) showed presence of phospho-serines but not phosphothreonines or phospho-tyrosines in (32P)-labeled Tat (Fig 8B) Thus, only serine residues of Tat were phosphorylated in vivo Phosphorylation of S16 and S46 residues of Tat in vivo We next investigated a possibility that Tat might be phosphorylated on S16 or S46 residues in vivo We generated mutants of Flag-Tat in which either or both Ser residues were substituted by Ala 293T cells were transfected with WT and mutant Tat-expressing vectors, Tat was precipitated with anti-Flag antibodies and analyzed on 15% SDS Tris-Tricine PAGE followed by PhosphoImager analysis Expression of Tat was verified by Western blotting (Fig 8C) While we could detect phosphorylation of WT Tat (Fig 8C, lane 2), the Tat S16A mutant and Tat S46A mutant were about 2–3 fold less phosphorylated (Fig 8C, middle and lower panels, lanes and 4) The Tat S16,46A http://www.retrovirology.com/content/3/1/78 double mutant was even less phosphorylated (Fig 8C, lane 5) Our results indicate that both S16 and S46 are likely to be phosphorylated in vivo Contribution of S16 and S46 residues of Tat to HIV-1 transcription We next investigated the functional relevance of Tat's S16 and S46 residues in HIV-1 transcription We generated mutants of Tat in which either or both Ser residues were substituted by Ala To ensure expression of the mutants, COS-7 cells were transfected with WT and mutant Tatexpressing vectors and cellular lysates were analyzed on 15% SDS Tris-Tricine PAGE followed by Western blot with anti-Tat antibodies As shown in Fig 9A, all Tat mutants were expressed, with the level of expression of Tat mutants higher than the WT Tat The higher expression level of non-tagged Tat mutants was a reproducible effect and was not a consequence of the difference in the amount of transfected DNA The effect of Tat mutations on the ability of Tat to activate HIV-1 LTR promoter was analyzed in HeLa cells co-transfected with Tat-expression vectors and HIV-1 LTR-LacZ reporter plasmid (Fig 9B) Non-mutated Tat (WT) increased the level of transcription by 400-fold (Fig 9B) HIV-1 transcription induction by the Tat S16A mutant was approximately 75% that of WT Tat (Fig 9B), while transactivation by the Tat S46A mutant was about times lower than with the WT Tat (Fig 9B) and induction by the double S16, 46A Tat mutant was 3times lower than that of WT Tat (Fig 9B) Thus, mutation of either Ser16 or Ser46 of Tat interferes with the level of Tat-transactivation and mutation of both residues has an additive effect Contribution of S16 and S46 residues of Tat to the HIV-1 viral production and Tat phosphorylation in the context of the integrated HIV-1 provirus We determined whether mutations of Tat S16A and/or S46A have an effect on the ability of Tat to induce HIV-1 transcription from an integrated HIV-1 provirus We used HLM-1 cells (AIDS Research and Reference Reagent Program) that were derived from HeLa-CD4+ cells containing an integrated copy of HIV-1 proviral genome with a Tatdefective mutation (termination linker at the first AUG) HLM-1 cells are negative for virus particle production, but can be induced to express high levels of infectious HIV-1 after transfection with Tat We transfected the HLM-1 cells with wild type or mutant Tat vectors and tested supernatants for the presence of HIV-1 particles using p24 gag antigen ELISA at day 0, day 1, day 2, day and day 14 posttransfection Neither S16A nor S46A mutants of Tat efficiently induced HIV-1 viral production (Fig 10A) The double S16, 46A mutant also had a reduced activity (Fig 10A) To phosphorylate Tat during virus replication, we pulsed HLM-1 cells transfected with WT and mutant Tat with (32P) orthophosphate and also treated the cells with Page of 21 (page number not for citation purposes) Retrovirology 2006, 3:78 http://www.retrovirology.com/content/3/1/78 A siRNA - control CDK2 CDK2 Western Blot CDK9 a-tubulin CDK2 expression, % of untreated control B 120 100 80 60 40 20 100 93 40 C siRNA α−CDK2 Preimmune (32P) kinase assay control CDK2 control + + + Tat Figure CDK2-directed siRNA inhibits CDK2 expression CDK2-directed siRNA inhibits CDK2 expression A, CDK2-directed siRNA inhibits expression of CDK2 HeLa cells were transfected with siRNAs targeting CDK2 (lane 3) or non-targeting control pool (control, lane 2) Lane 1, untransfected cells At 48 hours post-transfection cells were lysed and cellular extracts were resolved on 12% Tris-Tricine SDS-PAGE and analyzed by immunoblotting analysis with antibodies against CDK2, CDK9 or α-tubulin B, quantification of the CDK2 expression in panel A using α-tubulin expression level for normalization C, CDK2-directed siRNA inhibits enzymatic activity of CDK2 CDK2 was precipitated from cellular extracts prepared from HeLa cells transfected with siRNAs targeting CDK2 (lane 2) or non-targeting control (lanes and 3) Lanes and 2, precipitation with rabbit anti-CDK2 antibodies Lane 3, precipitation with rabbit preimmune serum Immunoprecipitates were incubated with γ-(32P)ATP and recombinant Tat (see Methods), resolved on 12% Tris-Tricine SDS-PAGE and analyzed by autoradiography on Phosphor Imager Position of Tat is indicated Page of 21 (page number not for citation purposes) Retrovirology 2006, 3:78 A http://www.retrovirology.com/content/3/1/78 Flag-Tat + + - control CDK2 siRNA kDa 37 - Western * 25 19 - Tat B Tat (32P) C Phosphorylation of Tat 120 100 80 60 40 20 100 29 Figure CDK2-directed siRNA blocks Tat phosphorylation CDK2-directed siRNA blocks Tat phosphorylation A, HeLa cells were infected with Adeno-Tat (lanes and 3) At hours post infection, cells were transfected with siRNAs targeting CDK2 (lane 3) or non-targeting control pool (lane 2) Lane – control cells At 48 hours post-infection cells were labeled with (32P)-orthophosphate for hours Whole cell extract was subjected to immunoprecipitation with anti-Flag antibodies, resolved by 15% Tris-Tricine SDS-PAGE, and transferred to polyvinylidene fluoride membrane A, immunoblot of the membrane with anti-Tat monoclonal antibodies using the 3,3'-diaminobenzidine enhancer system B, autoradiography of the membrane on Phosphor Imager screen C, quantification of the panel B Position of Tat is indicated by arrow The position of light chain of IgG recognized in anti-Flag immunoprecipitates by antimouse HRP-conjugated secondary antibodies is indicated by asterisk Page of 21 (page number not for citation purposes) Retrovirology 2006, 3:78 http://www.retrovirology.com/content/3/1/78 10%-30% Glycerol gradient I 10 11 12 13 RNAPII Brd4 HEXIM1 Cyclin T1 CDK9 CDK2 Flag-Tat Figure CDK2 co-migrate on glycerol gradient Tat and Tat and CDK2 co-migrate on glycerol gradient 293T cell lysated from the cells infected with Adeno-Tat were fractionated on 10%–30% glycerol gradients by centrifugation and analyzed with indicated antibodies by Immunoblotting okadaic acid Tat was immunoprecipitated with anti-Flag antibodies, resolved on 15% SDS PAGE and its phosphorylation was detected by PhosphoImager While WT Tat was phosphorylated, the mutants were not phosphorylated efficiently (Fig 10B) These data indicate that the S16A and S46A mutations of Tat interfere with the ability of Tat to activate integrated HIV-1 provirus, and prevent Tat phosphorylation during one round of viral replication Correlation of mutations in putative CDK2 recognition sites on Tat with disease progression in HIV infected humans As we discussed above, analysis of the sequence of Tat for the presence of the (S/T)0P1K2(K/R)3 consensus motif for serine phosphorylation by CDK2 [27,28] showed that several sequences partially matched this motif: 16SQP(K/ R)19 , 46 SYGR49 , 68SLSK71 We determined conservancy of S16, S46 and S68 residues We analyzed 158 sequences of Page 10 of 21 (page number not for citation purposes) Retrovirology 2006, 3:78 http://www.retrovirology.com/content/3/1/78 A Input IP:IgG - Flag-Tat IP: Flag - + + + * WB:Tat CDK2 WB: CDK2 siRNA control CDK2 Flag-Tat B - - + + WB:Tat Tat IP: Flag WB:CDK9 CDK9 WB:CDK2 C CDK2 control siRNA Flag-Tat - + CDK2 - + Tat WB:Tat IP: Flag Tat WB:Cyclin T1 Cyclin T1 WB:Cyclin T2 Cyclin T2a/b Figure A, CDK2 associates with Tat in cultured cells A, CDK2 associates with Tat in cultured cells Flag-tagged Tat was expressed in HeLa cells by Adeno-Tat infection and precipitated with anti-Flag antibodies from cellular lysate Co-precipitated proteins were resolved on 12% Tris-Tricine PAGE and analyzed by immunoblotting analysis with anti-CDK2 and anti-Tat antibodies Lane 1, input control without Tat Lane 2, input control with Tat Lanes and 4, extract without or with Tat precipitated with anti-Flag antibodies Lane 5, extract with Tat precipitated with preimmune mouse IgG The position of light chain of IgG recognized in anti-Flag immunoprecipitates by anti-mouse HRP-conjugated secondary antibodies is indicated by asterisk B, CDK2-specific siRNA inhibits association of Tat with CDK2 Flag-tagged Tat was expressed in 293T cells by transfection (lanes and 4) Cells were transfected with nontargeting (lanes and 2) or CDK2-specific (lanes and 4) siRNAs Lysates were precipitated with anti-Flag antibodies, resolved on 12% Tris-Tricine PAGE and immunoblotted with anti-Tat, anti-CDK9 or anti-CDK2 antibodies C, CDK2-specific siRNA does not affect association of Tat with cyclin T1 Flag-tagged Tat was expressed in 293T cells by transfection (lanes and 5) Cells were transfected with non-targeting (lanes and 3) or CDK2-specific (lanes and 5) siRNAs Lysates were precipitated with anti-Flag antibodies, resolved on 12% Tris-Tricine PAGE and immunoblotted with anti-Tat, anti-CDK9 or antiCDK2 antibodies Lane 1, input Page 11 of 21 (page number not for citation purposes) Retrovirology 2006, 3:78 http://www.retrovirology.com/content/3/1/78 A B IP: Tat Flag-Tat + kDa 24.5- - - pSer pThr Tat 19 - pTyr pH 3.5 13.5Start + - Flag- Tat Western kDa 25- Tat 19 - Tat (32P) (32P) Tat, % of WT - W T S1 6A S4 6A S1 6,4 6A C pH 1.9 120 100 80 60 40 20 Figure is phosphorylated on S16 and S46 residues in vivo HIV-1 Tat HIV-1 Tat is phosphorylated on S16 and S46 residues in vivo A, HeLa cells were infected with recombinant adenovirus expressing Flag-tagged Tat as described in Methods At 48 hours post infection cells were labeled with (32P)-orthophosphate for hours with μM okadaic acid (OA) Lane1, Flag-Tat was immunoprecipitated from whole cell extracts with anti-Flag antibodies and resolved by 15% Tris-Tricine SDS-PAGE Lane 2, control mock-transfected cells The picture is an autoradiogram B, Tat peptides were eluted from the gel shown in panel A by overnight incubation with trypsin and subjected to acid hydrolysis as described in Materials and Methods The hydrolyzed material was spotted on nitrocellulose plate and examined by twodimensional thin layer electrophoresis and autoradiography The indicated positions of non-radioactive phospho-amino acid standards were visualized by staining with 0.5% ninhydrin in ethanol C, Mutations of S16 and S46 reduce Tat phosphorylation in vivo 293T cells were transfected with vectors expressing Flag-tagged WT Tat (lane 2), Tat S16A (lane 3), Tat S46A (lane 4) or Tat S16,46A (lane 5) Lane 1, mock transfection At 48 hours post-transfection the cells were labeled with (32P)-orthophosphate for hours Whole cell extract was subjected for immunoprecipitation with anti-Flag antibodies, resolved by 15% TrisTricine SDS-PAGE, and analyzed by Western blotting with polyclonal anti-Tat antibodies and on Phosphor Imager Quantification is shown in the lower panel Position of Tat is indicated by arrow Page 12 of 21 (page number not for citation purposes) Retrovirology 2006, 3:78 A http://www.retrovirology.com/content/3/1/78 pTat - WT S16A S46A S16,46A kDa 13 - Tat 9- Transactivation, % of WT Tat B 120 100 80 60 40 20 500 WT 400 S16A 300 S46A S16,46A 200 100 Transactivation, Fold Figure of Ser16 and Ser46 of Tat reduce its transactivation potential Mutations Mutations of Ser16 and Ser46 of Tat reduce its transactivation potential A, COS-7 cells were transfected with WT Tat, Tat S16A, Tat S46A or Tat S16,46A expression vectors At 48 hours posttransfection, the cells were lysed Tat was immunoprecipitated from the lysates with rabbit polyclonal antibodies, resolved by 15% Tris-Tricine SDS-PAGE and immunoblotted with monoclonal anti-Tat antibodies B, HeLa cells were transfected with the HIV-1 LTR-LacZ expression vector alone (not shown here) and in combination with WT Tat, Tat S16A, Tat S46A or Tat S16,46A expression vectors At 48 hours posttransfection, cells were lysed and analyzed for β-galactosidase activity with ONPG Tat isolates deposited in the PubMed database Both S16 and S46 were highly conserved with an occurrence of 100% or nearly 100% (Fig 11) In contrast, S68 was present in 41%, and S70 – in 60% of the Tat isolates and all other serines were present in less than 50% (Fig 11) This analysis indicates that S16 and S46 residues might be critical for HIV-1 replication Because S16 and S46 residues were 100% conserved, it was not possible to analyze the effect of the mutation of these residues on the HIV-1 progression We took advantage of the notion that a lysine or arginine present in the fourth position of the (S/ T)0P1K2(K/R)3 consensus motif is critical for the recognition of the motif by CDK2 [27,28] Thus we analyzed whether (K/R)19 and R49 residues within 16SQP(K/R)19 and 46 SYGR49 sequences of Tat were conserved among different HIV-1 isolates and whether mutations in these residues correlated with apparent progression of disease in the patient from whom the isolates were obtained In this investigation, we studied 105 sequences of Tat deposited to PubMed database [34] Of these, 55 were obtained Page 13 of 21 (page number not for citation purposes) Retrovirology 2006, 3:78 http://www.retrovirology.com/content/3/1/78 A WT S16A S46A S16,46A 24000 p24, pg/ml 20000 16000 12000 8000 4000 0 14 Flag-Tat kDa 25- W T S1 6A S4 6A B S1 6,4 6A - Days in culture Tat (32P) 19 - (32P) Tat, % of WT 120 100 100 80 60 40 20 12.8 7.5 5.7 1.7 Figure 10 of S16 and S46 of Tat reduce its ability to induce viral production A, Mutations A, Mutations of S16 and S46 of Tat reduce its ability to induce viral production HLM1 is a HeLa derived cells containing one copy of integrated HIV-1 proviral genome with a Tat-defective mutation Various Flag-tagged Tat (WT Tat, Tat S16A, Tat S46A or Tat S16,46A) expression vectors were used for HLM-1 transfections Cells were cultured in complete media in absence of G418 for 14 days The supernatants were collected at Day 0, 1, 2, and 14, and analyzed for p24 by ELISA assay B, Mutations of S16 and S46 of Tat inhibit Tat phosphorylation during one round of viral replication HLM1 cells were transfected with vectors expressing Flag-tagged Tat (WT Tat, Tat S16A, Tat S46A or Tat S16,46A) At 48 hours post transfection the cells were labeled with (32P)-orthophosphate for hours with μM okadaic acid Flag-Tat was immunoprecipitated from whole cell extracts with anti-Flag antibodies and resolved by 15% Tris-Tricine SDS-PAGE The gel was dried and exposed to Phosphor Imager screen Lane 1, Wt Tat Lane 2, Tat S16A Lane 3, Tat S46A Lane 4, Tat S16,46A Lane 5, mock-transfected cells The picture is an autoradiogram Page 14 of 21 (page number not for citation purposes) Retrovirology 2006, 3:78 http://www.retrovirology.com/content/3/1/78 from patients who were not on antiretroviral treatment and were classified as being healthy, and 50 were from patients who were classified as being ill and who were on antiretroviral treatment We found that R49 was absolutely conserved, and thus no correlation could be obtained In contrast, Table shows that 29 (53%) of the "healthy" HIV patients had a (K/R)19 mutation compared to only (8%) of the "ill" HIV patients (Pearson Chi-square correlation 24.312, df = 1; P < 0.001) This result suggests physiological importance of mutation of position 19 of Tat for progression of HIV-1 disease, and are consistent with the possibility that 16SQP(K/R)19 sequence is a putative CDK2 recognition site in Tat Discussion Our recent studies indicate that Tat's role in HIV-1 transcription is extremely complex and may not confine solely to the interaction with CDK9/cyclin T1 We have previously reported that Tat interacts directly or indirectly with host cell protein phosphatase (PP1) and protein phosphatase 2A (PP2A) Tat binds to protein phosphatase-1 (PP1) and this binding is important for the induction of HIV-1 transcription by Tat [31,35] Tat interaction with PP1 is intriguing as PP1 regulates CDK9 phosphorylation in vivo [36] We recently showed that Tat binds to LIS1 protein, a product of lissencephaly gene which mutations cause a severe brain malformation [37] LIS1 resembles the B-subunit of PP2A and interacts with the catalytic subunit of PP2A; and LIS1 expression induces HIV-1 transcription [38] Thus Tat might also be able to interact with PP2A, although not directly with its catalytic subunit The current study adds more complexity to the Tat function showing that Tat might undergo phosphorylation by CDK2/cyclin E We hypothesized here that CDK2 affects HIV-1 transcription by phosphorylating Tat and that Tat phosphorylation might be important for HIV-1 transcription We show here that Tat undergoes phosphorylation in vivo on serine residues, and that CDK2 is involved in this phosphorylation Our findings also indicate that phosphorylation of Tat is important for HIV-1 transcription and the activation of integrated HIV-1 provirus In our previous work we demonstrated that CDK2/cyclin E phosphorylates the Cterminal domain of RNA polymerase II in vitro [39-41]; that CDK2 was required for Tat-dependent transcription in vitro, and that CDK2 phosphorylates HIV-1 Tat in vitro [20,41] CYC202 (R-roscovitine), a pharmacological inhibitor of CDK2, efficiently inhibited replication of wild type and HAART resistant HIV-1 mutants in T-cells, monocytes and PBMCs [42] indicating that CDK2 activity is required for HIV-1 replication Recently we showed that siRNA-directed against CDK2 inhibits Tat-induced HIV-1 transcription and HIV-1 viral replication [33] Thus our present study as well as our previous studies point to CDK2 as an important regulator of HIV-1 transcription Until recently CDK2/cyclin E was considered to be essential for cell cycle progression and that CDK2 regulates G1/ S transition by phosphorylating Rb-sequestering factors, including E2F [43] Recent findings challenged this role of CDK2 CDK2 knock-out mice were viable [44], suggesting that CDK2 is dispensable for proliferation and survival of most cell types Also, inhibition of CDK2 activity through expression of p27 Kip1, dominant-negative CDK2, antisense oligonucleotides or siRNA did not have an effect on growth of several tumor cell lines [45] Therefore, not being essential for cellular viability, CDK2 might present a feasible target for anti-HIV-1 therapeutics Previous attempts to detect Tat phosphorylation in vivo were not successful [25] It is possible that low level of Tat expression or fast dephosphorylation in the cells or during sample preparation may not allow easy detection of Tat phosphorylation For example, in the early studies Ben Berkhout and his colleagues could only detect Tat expression in COS-7 cells but not in HeLa cells [46-48] We found that expression of Flag-tagged Tat allowed higher levels of Tat expression especially with the adeno-virus mediated delivery Treatment with okadaic acid, which inhibits phosphatases of the PPP-family including PP1 and PP2A [49], significantly enhanced Tat phosphorylation (Fig 3), suggesting that Tat may be dynamically dephosphorylated by a cellular PPP-type phosphatase When we inhibited PP1 by over expression of the central domain of nuclear inhibitor of PP1 (NIPP1) [31] we did not detect changes in Tat phosphorylation (data not shown) Thus PP2A rather than PP1 is a candidate phosphatase to dephosphorylate Tat Our analysis showed that inhibition of CDK2 expression by siRNA substantially blocked Tat phosphorylation and prevented association of Tat with CDK2 Although these findings suggest that CDK2 might directly phosphorylate Tat, we also cannot rule out a possibility that inhibition of Table 2: Mutation of (K/R)19 residue sequence of Tat and Sickness Status Healthy Non-mutated Tat (K/R)19 Tat (K/R)19(T, A or G) Total Sick Total 26 29 55 46 50 72 33 105 Page 15 of 21 (page number not for citation purposes) Retrovirology 2006, 3:78 http://www.retrovirology.com/content/3/1/78 120 Occurance of Serine, % 100 97 100 80 60 60 46 40 41 29 28 15 20 12 10 73 74 16 23 46 61 62 68 70 75 Tat Amino Acid Position Figure 11 Serine residues at position 16 and 46 are highly conserved in Tat isolates Serine residues at position 16 and 46 are highly conserved in Tat isolates The 158 sequences of Tat isolates deposited to PubMed database were analyzed for the presence of serines at position 16, 23, 46, 61, 68, 70, 73, 74 and 75 Presence of a serine at the indicated position is presented as a percent of the total number of the isolates analyzed CDK2 reduces the activity of another kinase that in turn might be involved in Tat phosphorylation Finding that Tat co-migrates with CDK2 on glycerol gradient and also co-precipitated with CDK2 confirms our previous observation that Tat-associated kinase activity contained CDK2 [41] CDK2-directed siRNA significantly reduced association of CDK2 to Tat, probably by reducing the amount of CDK2 available to interact with Tat We found that Tat is phosphorylated on serine residues in vivo We previously suggested that the 16SQPK19 and K41 × L43 sequences of Tat interact with CDK2 and cyclin E respectively, and that S16 is phosphorylated by CDK2 [20] In the present study we found that both S16 and S46 of Tat are potential phosphorylation sites As S46 is adjacent to the K41 × L43 sequence of Tat, it is likely that the K41 × L43 sequence participates in binding to CDK2 rather than to cyclin E, as we originally suggested Interestingly, recombinant CDK2/cyclin E only phosphorylated full length Tat 1–72 but not the 15 amino acid peptides of Tat, 9EPWKHPGSQPKTACN23 or 37CFTTKGLGISYGRKK51 (AIDS Research and Reference Reagents Program, NIH), containing only the phosphorylation sites (data not shown), which may indicate a requirement of additional sequences of Tat for its interaction with CDK2/cycline E Another explanation is that full length Tat creates a favorable conformation for phosphorylation by CDK2 The sequences 16SQP(K/R)19 and 46SYGR49 only partially match the CDK2 (S/T)0P1K2(K/R)3 phosphorylation motif Although the catalytic efficiency of CDK2-cyclin A is impaired 2000-fold, when Pro1 is substituted with Ala in a short synthetic peptide substrate, physiological substrates for both CDK2-cyclin A and CDK2-cyclin E often contain phosphorylation motifs replaced with sub optimal determinants [28] In such sub optimal substrates phosphorylation is enhanced by a cyclin-binding motif that compensates for otherwise poor catalysis [28] Therefore, binding of cyclin E still might be important for efficient phosphorylation of Tat by CDK2 Using mutation analysis, we found that S16 and S46 are equally important for activation of integrated proviral DNA The single point mutants did not show a significant level of activation, and the double mutant Tat was completely inactive in HLM-1 cells In contrast, mutation of S16 and S46 moderately reduced activation of HIV-1 tran- Page 16 of 21 (page number not for citation purposes) Retrovirology 2006, 3:78 scription from the episomal promoter Thus Tat S16 and S46 residues are important for transcription of a full genomic HIV-1 template containing natural chromatin structure The effect of alanine mutation of S46 is at variance with the previously published observation that alanine mutation of S46 induces Tat-transactivation [50] We did not see an increase of Tat transactivation with all mutants tested Thus we cannot explain this discrepancy Tat was proposed to form aggregates in the nucleus [51] Using yeast two-hybrid system, we found no evidence that Tat forms dimers in yeast cells (not shown) Therefore, it remains to be determined why Tat should undergo phosphorylation to be fully active as a transcriptional activator We did not detect a difference between WT and mutant Tat in ability to bind to TAR RNA (not shown) We observed an increase in the expression of untagged Tat with mutations in the S16 or Ser46 Tat residues and particular of the double mutant of Tat (Fig 8A) An increase in Tat expression was observed earlier by Rice and Carlotti with a mutant of Tat that lacked first 36 N-terminal amino acids [50] Thus the amount of Tat expressed in the cells might be stringently controlled and the excess of Tat might have a negative effect on Tat transactivation Another possibility is that Tat may need to undergo nonproteolytic ubiquitination by Hdm2 ubiquitin ligase [22] to be fully active as a transactivator It is possible that Tat phosphorylation may facilitate ubiquitination of Tat by Hdm2 similar to phosphorylation-dependent ubiquitination of p53 by Hdm2 [52] Analysis of Tat sequences available in the PubMed showed that Tat isolates contain from to 11 serine residues In addition to the highly conserved S16 and S46 residues, Tat contains less conserved serines at positions 23, 61, 62, 68, 70, 73, 74 and 75 Analysis of the 16SQP(K/ R)19 and 46SYGR49 sequences of Tat, showed that R49 is conserved among different HIV-1 isolates Interestingly, mutations in the (K/R)19 residue showed correlation with non-progression of HIV-1 disease Thus (K/R)19 residue which is part of a putative CDK2 recognition site in Tat, may be important for progression of HIV-1 disease Future study will address whether mutation of (K/R)19 residue is important for phosphorylation of Tat by CDK2 and whether mutations in this residue affect viral replication Taken together, our findings indicate that Tat is phosphorylated in vivo and that phosphorylation of Tat is important for the activation of integrated HIV-1 provirus Our finding also indicates that CDK2 associates with Tat and thus is likely to phosphorylate Tat directly in vivo Our findings open the door to the evaluation of the potential efficiency of presently available CDK2 inhibitors and specifically designed future inhibitors to disrupt CDK2-Tat association http://www.retrovirology.com/content/3/1/78 Methods Materials 293T cells and COS-7 cells were purchased from ATCC (Manassas, VA) HeLa-MAGI cells [53], HLM-1 cells [54], anti-Tat rabbit polyclonal (HIV-1 BH10 Tat antiserum, [55]) and monoclonal (NT3 2D1.1, courtesy of Dr Jonathan Karn) antibodies were received from the AIDS Research and Reference Reagents Program (NIH) AntiFlag monoclonal antibodies, anti-α-tubulin antibodies, protein (G) and protein (A) agarose and okadaic acid were purchased from Sigma (Atlanta, GA) All radioactive reagents were purchased from GE Health Care Life Sciences The 3,3'-diaminobenzidine enhanced liquid substrate system for membrane ELISA (DABM) was purchased from Sigma (St Louis, MO) Antibodies for CDK2, CDK9, cyclin T1 and cyclin T2 were purchased from Santa Cruz Biotechnology (Santa Cruz, CA) Antibodies against RNAPII were from Babco Anti-Brd4 and anti-HEXIM1 antibodies were a gift from Dr.Q Zhou (University of California, Berkeley) HIV-1 Tat was expressed in Escherichia coli and purified on Aquapore RP-300 column (Applied Biosystems, Foster City, CA) by reverse-phase chromatography as we described [20] Plasmids Tat expression plasmid was a gift from Dr Ben Berkhout (University of Amsterdam) [48] The Flag-Tat was cloned into the adeno-CMV-link vector as described below and verified by sequencing The S16A and S46A mutations of the sequence of Tat were made according to the QuickChange site-directed mutagenesis protocol of Stratagene, using the appropriate primers and templates The sequences of the DNA constructs were verified by sequencing using a commercial service from Macrogen (Seoul, Korea) CDK2/cyclin E purification CDK2 and cyclin E were purified from lysates of Sf9 insect cells infected with baculoviruses producing CDK2 and cyclin E Proteins were purified essentially as described earlier [56] Briefly, ml of cells (from 250 ml of culture) was lysed with 16 ml of lysis buffer (50 mM Tris-HCl, pH 8.0, 10 mM 2-mercaptoethanol, 10% glycerol and with PMSF), homogenized on ice and centrifuged at 45,000 g for hr at 4°C Supernatant was loaded on Mono-Q 10/ 10 column (Amersham, USA) Two separate cell cultures, one infected with CDK2-expressing baculovirus and the other one infected with cyclin E-expressing baculovirus were used for purification The Mono-Q fractions containing CDK2 or cyclin E were mixed 1:1 and loaded onto Superdex column (Sephadex H200, Amersham, USA) Purity of CDK2/cyclin E was checked on 12% PAGE followed by Coomassie staining (Additional file 1) We also analyzed the Superdex fractions by immunoblotting with andti-CDK2 antibodes and assayed their enzymatic activ- Page 17 of 21 (page number not for citation purposes) Retrovirology 2006, 3:78 ity using histone H1 and purified Tat proteins as substrates Fractions containing CDK2/cyclin E were concentrated using Microcon tubes (Amicon, USA) In vitro kinase assay CDK2 kinase assays were performed at 30°C for 30 in kinase assay buffer (50 mM HEPES-KOH, pH 7.9, 10 mM MgCl2, mM EGTA, 2.5 mM DTT) containing histone H1 or purified Tat protein, 200 μM ATP and (γP32)ATP A mixture was incubated for 30 at 30°C, reaction was stopped with μl of 4× SDS buffer and resolved on 12% PAGE Immunoprecipitation of CDK2 and kinase assay with Tat 293T cells were transfected with CDK2-directed or nontargeting siRNA At 48 hours after transfection cells were lysed in whole cell lysis buffer About 50 μg of protein lysate was subjected to precipitation with anti-CDK2 rabbit antibodies (600 ng/IP) on 40 μl protein A agarose beads (50% slurry) (Sigma) As a control, rabbit preimmune serum was used Precipitation was carried out for hrs at 4°C The beads were washed with TNN buffer, then with TTK buffer and supplemented with 20 μl of kinase mixture containing TTK buffer, 100 μM ATP, 0.5 μCi of γ(32P)ATP and μg of purified Tat The kinase reaction was carried out for 15 at 30°C, reaction was stopped with μl of 4× SDS-loading buffer and resolved on 12% TrisTricine gel The gel was stained with Coomassie blue, dried and exposed to Phosphor Imager screen Fractionation of cellular lysates on glycerol gradient 293T cells were infected with Adeno-Tat virus with MOI 1, and incubated overnight The cells in 100 mm plate were lysed with 0.5 ml of whole cell lysis buffer (50 mM TrisHCl, pH 7.5, 0.5 M NaCl, 1% NP-40, 0.1% SDS) supplemented with protease cocktail (Sigma) and RNasin (Amersham) Cell lysates were clarified by centrifugation for 30 at 10,000 g and loaded on top of 10% to 30% glycerol (9 ml) gradient Glycerol gradient buffer contained 20 mM HEPES-KOH, pH 7.9, 150 mM KCl, 200 μM EDTA The gradient was spun in SW 41Ti rotor (Beckman) at 38,000 rpm for 18 hours Fractions (0.5 ml) were collected through a needle inserted to the bottom of the tube and analyzed by Immunoblotting Tat trypsinization and chromatographic separation of peptides Non-phosphorylated and phosphorylated Tat were resolved by 15% Tris-Tricine SDS-PAGE A gel piece containing Tat was crushed and incubated with μg of porcine trypsin (Promega, Madison, WI) in 0.1 M NaHCO3 (pH 7.9) overnight at 37°C The extracted peptides were lyophilized, dissolved in 0.1% TCA and separated by http://www.retrovirology.com/content/3/1/78 reverse-phase chromatography on a μRPC C2/C18 ST 4.6/ 100 column (Amersham Pharmacia Biotech) using AKTA purifier (AmershamPharmaciaBiotech) Eluent A was 0.1% TCA in water and eluent B was 0.1% TCA in 90% acetonitrile The gradient was 5% B for column volumes (CVs), 5–50% B for 20 CVs, 50–100% B for 12 CVs and 100% B for CVs The flow rate was 0.5 ml/min MALDI-TOF mass spectrometry and peptide sequencing Fractions from the HPLC separation described above were lyophilized Multiple peptide sequences were determined in a single run by Applied Biosystems Maldi-TOF/TOF 4700 proteomics analyzer (25–30,000 resolution in reflectron mode, ppm accuracy with IS, subfmole sensitivity for peptide mass fingerprints (PMF), fmole sensitivity for PSD/CID capacity of >36,000 PMF per 24 hours) Data were analyzed utilizing a local multi-processor installation of MASCOT MS PMF and MS/MS PSD, CID peptide identification software GPS also supports an integrated MS-MS/MS mode and a chromatographic separation mode with SEQUEST-like capability Preparation of Adeno-Tat The E1-deleted recombinant Ad carrying Tat was generated as previously described [31] Briefly, a cDNA fragment encoding the full length HIV-1 Tat protein was cloned into the plasmid pCXN was subcloned in the pAd.CMV link plasmid The Tat-coding DNA corresponds to the HIV-1 isolate P9.3 from United Kingdom (Accession number AF324447) The DNA sequence is ATGGACTACAAGGACGACGA TGACAAAGAA TTCATGGAGC CAGTAGATCCTAGACTAGAG CCCTGGGAGC ATCCAGGAAG TCAGCCTAAG ACTGCTTGTACCCCTTGCTA TTGTAAAAAG TGTTGCTTTC ATTGCCAAGT TTGTTTCACAACAAAAGGCT TAGGCATCTC CTATGGCAGG AAGAAGCGGA GACAGCGACGAAGAGCTCCT CAAGACAGTC AGACTCATCA GGCTTCTCTA TCAAAGCAATCCCTACCCCA AACCCAGAGG GACTCGACAG GCCCGGAAGA ATCGAAGAAGGAGGTGGAGA GCAAGGCAGAGACAGATCGA TTCGATTA It corresponds to the protein sequence of Tat containing Flag epitope at its N-terminusMDYKDDDDKEFMEPVDPRLEPWEHPGSQPKTACTPCYCKKCCFHCQVCFTTKGLGISYGRKKRRQRRRAPQDSQTHQASLSKQSLPQTQRDSTGPEESKKEVESKAETDRFD pAd.CMVlink and Cla I digested adenoviral DNA were co-transfected into HEK293 cells at a ratio of 3:1 by calcium phosphate precipitation to allow the recombination The virus was purified through three rounds of plaque-purification Viruses were replicated in HEK293 cells and were purified from a cell lysate by two rounds of CsCl density gradient centrifugation The purified virus was desalted on a Bio-Gel P-6 desalting column (Bio-Rad Laboratories, Hercules, CA) equilibrated with PBS The titer of the virus preparation was determined both by Page 18 of 21 (page number not for citation purposes) Retrovirology 2006, 3:78 absorbency at 260 nm and by plaque assay The particle to plaque forming unit ratio was less than 100 Purified viruses were suspended in PBS at the desired concentrations Tat phosphorylation in vivo HeLa cells were infected with recombinant Adenovirus carrying Flag-tagged Tat prepared as we described [31] The purified virus had a particle to plaque forming unit (Pfu) ratio of less than 100 We added approximately 10 Pfu per cell to achieve high level of Tat expression in infected HeLa cells At 48 hours post infection the media was changed for hour to a phosphate-free DMEM media (Life Technologies, Rockville, MD) containing no serum Then the media was changed to phosphate-free DMEM supplemented with 0.5 mCi/ml of (32P)-orthophosphate and cells were further incubated for hours at 37°C Where indicated, μM okadaic acid (Sigma) was added to block cellular PPP-phosphatases Cells were washed with PBS and lysed in whole cell lysis buffer (50 mM Tris-HCl, pH 7.5, 0.5 M NaCl, 1% NP-40, 0.1% SDS) supplemented with protease cocktail (Sigma) After 10 on ice, cellular material was scraped and then centrifuged at 14,000 rpm, 4°C for 30 The supernatant was recovered and immediately used for immunoprecipitation Tat was precipitated with anti-Flag monoclonal antibodies coupled to protein G agarose and with polyclonal anti-Tat antibodies coupled to protein A agarose for h at 4°C in a TNN Buffer containing 50 mM Tris-HCl, pH 7.5, 0.15 M NaCl, and 1% NP-40 The immunoprecipitated Tat was recovered by heating for at 100°C in Tricine SDSloading buffer, resolved on 15% Tris-Tricine SDS-PAGE [32] and transferred to polyvinylidene fluoride (PVDF) membranes (Millipore, Allen, TX) The membrane was analyzed with anti-Tat monoclonal antibodies using 3,3'Diaminobenzidine enhancer system (Sigma) and was also exposed to Phosphor Imager screen (Packard Instruments, Wellesley, MA) http://www.retrovirology.com/content/3/1/78 and at pH 3.5 in the second direction Cold standards were visualized by staining the plate with 0.25% ninhydrine dissolved in ethanol Positions of labeled phosphoamino acids were analyzed with Phosphor Imager (Packard Instruments, Wellesley, MA) Transfection and HIV-1 detection from HLM1 cells HLM-1cells were derived from HeLa-T4+ cells integrated with one copy of HIV-1 genome containing a Tat-defective mutation The mutation was introduced as a triple termination linker (TTL) at the first AUG of Tat gene [54] HLM1 cells are negative for virus particle production HLM1 cells are negative for virus particle production HLM1 cells can be induced to express non-infectious HIV-1 particles after transfection with Tat cDNA, or by treatment with mitogens such as TNF-α or sodium butyrate HLM1 cells were grown in DMEM media containing 100 μg/ml of G418, plus 1% streptomycin, penicillin antibiotics and 1% L-Glutamine (Gibco/BRL) The cells grown up to 75% confluence were transfected with Tat expression vectors, including wild type Tat, S16A, S46A, and S16A/S46A mutant Tat plasmids using the calcium phosphate method The transfected cells were washed after four hrs and fresh complete DMEM media with 10% fetal bovine was added for the remainder of the experiment The p24 gag antigen was detected in the supernatants of transfected cells using a standard ELISA kit (Abbott) siRNA treatment CDK2-directed siRNA pool (M-003236-03-005) and negative control pool (D-001206-13-05) were purchased from Dharmacon (Dallas, TX) The siRNAs were transfected at final concentration of 100 nM using Lipofectamin reagent (Invitrogen) according to the manufacturer's recommendations The siRNAs were incubated with cells for days before cells were labeled with 32P or lysed for Western blotting analysis Competing interests Phosphoamino acid analysis The analysis was carried out on the Hunter thin layer peptide mapping electrophoresis system (CBS, Del Mar, CA) according to the manufacturer's recommendations Briefly, phosphorylated Tat, prepared as described above was resolved on 15% SDS-Tris-Tricine PAGE and the gel was dried on a Whatman paper The portion of the gel containing Tat was excised, rehydrated and treated overnight with trypsin to elute Tat The eluted peptides were boiled in 5.7 M HCl at 110°C to liberate (32P)-labeled phospho-amino acids as described [57] After the hydrolysis, the sample was lyophilized and resuspended in the buffer for pH 1.9 electrophoresis also containing the phosphoamino acid standards at 0.06 mg/ml The sample was resolved by thin-layer electrophoresis on a cellulose plate (CBS, Del Mar, CA) at pH 1.9 in the first direction The author(s) declare that they have no competing interests Authors' contributions TA purified recombinant CDK2/cyclin E, performed in vitro Tat phosphorylation, carried out the experiments with the CDK2-directed siRNA, CDK2-Tat precipitation experiments, Western blot analysis of glycerol gradients and also helped with in vivo (32P) phosphorylation experiments and with Tat mutagenesis RB and ZK carried out experiments with live virus MJ prepared adeno-Tat virus, helped to analyze the expression of Tat in cultured cells and prepared samples for MALDI-TOF analysis MJ and SN were also running glycerol gradients SC performed statistical analysis of the HIV-1 isolates EE performed MALDI TOF analysis of Tat peptides WS, VRG and FK par- Page 19 of 21 (page number not for citation purposes) Retrovirology 2006, 3:78 ticipated in the design and discussion of the study SN performed in vivo Tat phosphorylation experiments, phosphoaminoacid analysis of Tat and Tat mutagenesis, and also performed general control and coordination of the study All authors read and approved the manuscript Additional material Additional File Purification of CDK2/cyclin E Mixed mono Q fractions of CDK2 and cyclin E (Mono Q lane) were purified on Superdex column Fractions 37, 39, 41, 43, and 45 were analyzed for the presence of CDK2 and cyclin E by Coumassie staining Click here for file [http://www.biomedcentral.com/content/supplementary/17424690-3-78-S1.pdf] Acknowledgements This work was supported by NIH Grant R21 AI 156973-01 (to S N.), by NHLBI Research Grant UH1 HL03679 from the National Institutes of Health and The Office of Research on Minority Health This work was also supported by grant G12 RR003048 from the RCMI Program, Division of Research Infrastructure, National Center for Research Resources, NIH (to W.S.) and by NIH grants AI44357, AI43894 to FK, and Research Enhancement Fund (REF, GW) to Akos Vertes and F Kashanchi We thank Dr Eric Eccleston for help with MALDI-TOF The authors would like to thank members of Dr Victor Gordeuk's laboratory at the Center for Sickle Cell Disease at Howard University for valuable discussions We also thank Dr Ajit Kumar for permission to use Hunter thin layer peptide mapping electrophoresis system We thank Qiang Zhou (University of California, Berkeley) for the gift of ant-Brd4 and HEXIM1 antibodies http://www.retrovirology.com/content/3/1/78 10 11 12 13 14 15 16 17 18 19 20 References Brady J, Kashanchi F: Tat gets the "green" light on transcription initiation Retrovirology 2005, 2:69 Brigati C, Giacca M, Noonan DM, Albini A: HIV Tat, its TARgets and the control of viral gene expression FEMS Microbiol Lett 2003, 220:57-65 Coadou G, Gharbi-Benarous J, Megy S, Bertho G, Evrard-Todeschi N, Segeral E, Benarous R, Girault JP: NMR studies of the phosphorylation motif of the HIV-1 protein Vpu bound to the F-box protein beta-TrCP Biochemistry 2003, 42:14741-14751 Agostini I, Popov S, Hao T, Li JH, Dubrovsky L, Chaika O, Chaika N, Lewis R, Bukrinsky M: Phosphorylation of Vpr regulates HIV type nuclear import and macrophage infection AIDS Res Hum Retroviruses 2002, 18:283-288 Yang X, Gabuzda D: Mitogen-activated protein kinase phosphorylates and regulates the HIV-1 Vif protein J Biol Chem 1998, 273:29879-29887 Cheng H, Hoxie JP, Parks WP: The conserved core of human immunodeficiency virus type Nef is essential for association with Lck and for enhanced viral replication in T-lymphocytes Virology 1999, 264:5-15 Fouts DE, True HL, Cengel KA, Celander DW: Site-specific phosphorylation of the human immunodeficiency virus type-1 Rev protein accelerates formation of an efficient RNA-binding conformation Biochemistry 1997, 36:13256-13262 Kim YK, Bourgeois CF, Isel C, Churcher MJ, Karn J: Phosphorylation of the RNA polymerase II carboxyl-terminal domain by CDK9 is directly responsible for human immunodeficiency virus type Tat-activated transcriptional elongation Mol Cell Biol 2002, 22:4622-4637 Zhu Y, Pe'ery T, Peng J, Ramanathan Y, Marshall N, Marshall T, Amendt B, Mathews MB, Price DH: Transcription elongation fac- 21 22 23 24 25 26 27 tor P-TEFb is required for HIV-1 tat transactivation in vitro Genes Dev 1997, 11:2622-2632 Raha T, Cheng SW, Green MR: HIV-1 Tat stimulates transcription complex assembly through recruitment of TBP in the absence of TAFs PLoS Biol 2005, 3:e44 Jeang KT, Berkhout B, Dropulic B: Effects of integration and replication on transcription of the HIV-1 long terminal repeat J Biol Chem 1993, 268:24940-24949 Jeang KT, Berkhout B: Kinetics of HIV-1 long terminal repeat trans-activation Use of intragenic ribozyme to assess ratelimiting steps J Biol Chem 1992, 267:17891-17899 Kashanchi F, Piras G, Radonovich MF, Duvall JF, Fattaey A, Chiang CM, Roeder RG, Brady JN: Direct interaction of human TFIID with the HIV-1 transactivator tat Nature 1994, 367:295-299 Herrmann CH, Rice AP: Lentivirus Tat proteins specifically associate with a cellular protein kinase, TAK, that hyperphosphorylates the carboxyl-terminal domain of the large subunit of RNA polymerase II: candidate for a Tat cofactor J Virol 1995, 69:1612-1620 Yang X, Gold MO, Tang DN, Lewis DE, Aguilar-Cordova E, Rice AP, Herrmann CH: TAK, an HIV Tat-associated kinase, is a member of the cyclin-dependent family of protein kinases and is induced by activation of peripheral blood lymphocytes and differentiation of promonocytic cell lines Proc Natl Acad Sci U S A 1997, 94:12331-12336 Kiernan RE, Vanhulle C, Schiltz L, Adam E, Xiao H, Maudoux F, Calomme C, Burny A, Nakatani Y, Jeang KT, Benkirane M, Van Lint C: HIV-1 tat transcriptional activity is regulated by acetylation Embo J 1999, 18:6106-6118 Ott M, Schnolzer M, Garnica J, Fischle W, Emiliani S, Rackwitz HR, Verdin E: Acetylation of the HIV-1 Tat protein by p300 is important for its transcriptional activity Curr Biol 1999, 9:1489-1492 Deng L, de la Fuente C, Fu P, Wang L, Donnelly R, Wade JD, Lambert P, Li H, Lee CG, Kashanchi F: Acetylation of HIV-1 Tat by CBP/ P300 increases transcription of integrated HIV-1 genome and enhances binding to core histones Virology 2000, 277:278-295 Cujec TP, Okamoto H, Fujinaga K, Meyer J, Chamberlin H, Morgan DO, Peterlin BM: The HIV transactivator TAT binds to the CDK-activating kinase and activates the phosphorylation of the carboxy-terminal domain of RNA polymerase II Genes Dev 1997, 11:2645-2657 Deng L, Ammosova T, Pumfery A, Kashanchi F, Nekhai S: HIV-1 Tat interaction with RNA polymerase II C-terminal domain (CTD) and a dynamic association with CDK2 induce CTD phosphorylation and transcription from HIV-1 promoter J Biol Chem 2002, 277:33922-33929 Bres V, Tagami H, Peloponese JM, Loret E, Jeang KT, Nakatani Y, Emiliani S, Benkirane M, Kiernan RE: Differential acetylation of Tat coordinates its interaction with the co-activators cyclin T1 and PCAF Embo J 2002, 21:6811-6819 Bres V, Kiernan RE, Linares LK, Chable-Bessia C, Plechakova O, Treand C, Emiliani S, Peloponese JM, Jeang KT, Coux O, Scheffner M, Benkirane M: A non-proteolytic role for ubiquitin in Tat-mediated transactivation of the HIV-1 promoter Nat Cell Biol 2003, 5:754-761 Boulanger MC, Liang C, Russell RS, Lin R, Bedford MT, Wainberg MA, Richard S: Methylation of Tat by PRMT6 regulates human immunodeficiency virus type gene expression J Virol 2005, 79:124-131 Brand SR, Kobayashi R, Mathews MB: The Tat protein of human immunodeficiency virus type is a substrate and inhibitor of the interferon-induced, virally activated protein kinase, PKR J Biol Chem 1997, 272:8388-8395 Hauber J, Bouvier M, Malim MH, Cullen BR: Phosphorylation of the rev gene product of human immunodeficiency virus type J Virol 1988, 62:4801-4804 Herrmann CH, Rice AP: Specific interaction of the human immunodeficiency virus Tat proteins with a cellular protein kinase Virology 1993, 197:601-608 Koepp DM, Schaefer LK, Ye X, Keyomarsi K, Chu C, Harper JW, Elledge SJ: Phosphorylation-dependent ubiquitination of cyclin E by the SCFFbw7 ubiquitin ligase Science 2001, 294:173-177 Page 20 of 21 (page number not for citation purposes) Retrovirology 2006, 3:78 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 Stevenson-Lindert LM, Fowler P, Lew J: Substrate specificity of CDK2-cyclin A What is optimal? J Biol Chem 2003, 278:50956-50960 http://us.expasy.org/tools/findpept.html: Bennett KL, Stensballe A, Podtelejnikov AV, Moniatte M, Jensen ON: Phosphopeptide detection and sequencing by matrixassisted laser desorption/ionization quadrupole time-offlight tandem mass spectrometry J Mass Spectrom 2002, 37:179-190 Ammosova T, Jerebtsova M, Beullens M, Voloshin Y, Ray PE, Kumar A, Bollen M, Nekhai S: Nuclear protein phosphatase-1 regulates HIV-1 transcription J Biol Chem 2003, 278:32189-32194 Schagger H, Bentlage H, Ruitenbeek W, Pfeiffer K, Rotter S, Rother C, Bottcher-Purkl A, Lodemann E: Electrophoretic separation of multiprotein complexes from blood platelets and cell lines: technique for the analysis of diseases with defects in oxidative phosphorylation Electrophoresis 1996, 17:709-714 Ammosova T, Berro R, Kashanchi F, Nekhai S: RNA interference directed to CDK2 inhibits HIV-1 transcription Virology 2005, 341:171-178 http://www.ncbi.nlm.nih.gov/entrez: Ammosova T, Jerebtsova M, Beullens M, Lesage B, Jackson A, Kashanchi F, Southerland W, Gordeuk VR, Bollen M, Nekhai S: Nuclear targeting of protein phosphatase-1 by HIV-1 TAT protein J Biol Chem 2005 Ammosova T, Washington K, Debebe Z, Brady J, Nekhai S: Dephosphorylation of CDK9 by protein phosphatase 2A and protein phosphatase-1 in Tat-activated HIV-1 transcription Retrovirology 2005, 2:47 Epie N, Ammosova T, Sapir T, Voloshin Y, Lane WS, Turner W, Reiner O, Nekhai S: HIV-1 Tat interacts with LIS1 protein Retrovirology 2005, 2:6 Epie N, Ammosova T, Turner W, Nekhai S: Inhibition of PP2A by LIS1 increases HIV-1 gene expression Retrovirology 2006, 3:65 Nekhai S, Shukla RR, Kumar A: A human primary T-lymphocytederived human immunodeficiency virus type Tat-associated kinase phosphorylates the C-terminal domain of RNA polymerase II and induces CAK activity J Virol 1997, 71:7436-7441 Nekhai S, Shukla RR, Fernandez A, Kumar A, Lamb NJ: Cell cycledependent stimulation of the HIV-1 promoter by Tat-associated CAK activator Virology 2000, 266:246-256 Nekhai S, Zhou M, Fernandez A, Lane WS, Lamb NJ, Brady J, Kumar A: HIV-1 Tat-associated RNA polymerase C-terminal domain kinase, CDK2, phosphorylates CDK7 and stimulates Tat-mediated transcription Biochem J 2002, 364:649-657 Agbottah E, de la Fuente C, Nekhai S, Barnett A, Gianella-Borradori A, Pumfery A, Kashanchi F: Antiviral activity of CYC202 in HIV1 infected cells J Biol Chem 2004 Reed SI: Control of the G1/S transition Cancer Surv 1997, 29:7-23 Malumbres M, Hunt SL, Sotillo R, Martin J, Odajima J, Martin A, Dubus P, Ortega S, Barbacid M: Driving the cell cycle to cancer Adv Exp Med Biol 2003, 532:1-11 Tetsu O, McCormick F: Proliferation of cancer cells despite CDK2 inhibition Cancer Cell 2003, 3:233-245 Verhoef K, Koper M, Berkhout B: Determination of the minimal amount of Tat activity required for human immunodeficiency virus type replication Virology 1997, 237:228-236 Verhoef K, Bauer M, Meyerhans A, Berkhout B: On the role of the second coding exon of the HIV-1 Tat protein in virus replication and MHC class I downregulation AIDS Res Hum Retroviruses 1998, 14:1553-1559 Verhoef K, Berkhout B: A second-site mutation that restores replication of a Tat-defective human immunodeficiency virus J Virol 1999, 73:2781-2789 Fernandez JJ, Candenas ML, Souto ML, Trujillo MM, Norte M: Okadaic acid, useful tool for studying cellular processes Curr Med Chem 2002, 9:229-262 Rice AP, Carlotti F: Mutational analysis of the conserved cysteine-rich region of the human immunodeficiency virus type Tat protein J Virol 1990, 64:1864-1868 Bogerd HP, Fridell RA, Blair WS, Cullen BR: Genetic evidence that the Tat proteins of human immunodeficiency virus types and can multimerize in the eukaryotic cell nucleus J Virol 1993, 67:5030-5034 http://www.retrovirology.com/content/3/1/78 52 53 54 55 56 57 Chernov MV, Bean LJ, Lerner N, Stark GR: Regulation of ubiquitination and degradation of p53 in unstressed cells through Cterminal phosphorylation J Biol Chem 2001, 276:31819-31824 Kimpton J, Emerman M: Detection of replication-competent and pseudotyped human immunodeficiency virus with a sensitive cell line on the basis of activation of an integrated betagalactosidase gene J Virol 1992, 66:2232-2239 Sadaie MR, Hager GL: Induction of developmentally programmed cell death and activation of HIV by sodium butyrate Virology 1994, 202:513-518 Hauber J, Perkins A, Heimer EP, Cullen BR: Trans-activation of human immunodeficiency virus gene expression is mediated by nuclear events Proc Natl Acad Sci U S A 1987, 84:6364-6368 Rosenblatt J, De Bondt H, Jancarik J, Morgan DO, Kim SH: Purification and crystallization of human cyclin-dependent kinase J Mol Biol 1993, 230:1317-1319 Cooper JA, Sefton BM, Hunter T: Detection and quantification of phosphotyrosine in proteins Methods Enzymol 1983, 99:387-402 Publish with Bio Med Central and every scientist can read your work free of charge "BioMed Central will be the most significant development for disseminating the results of biomedical researc h in our lifetime." Sir Paul Nurse, Cancer Research UK Your research papers will be: available free of charge to the entire biomedical community peer reviewed and published immediately upon acceptance cited in PubMed and archived on PubMed Central yours — you keep the copyright BioMedcentral Submit your manuscript here: http://www.biomedcentral.com/info/publishing_adv.asp Page 21 of 21 (page number not for citation purposes) ... 13 9- Tat (32P) Tat B no Tat Tat (Phospho )Tat I II Analysis HIV-1 Tat phosphorylated by CDK2/ cyclin E in vitro Figure of Analysis of HIV-1 Tat phosphorylated by CDK2/ cyclin E in vitro A, Tat is... CDK2/ cyclin E and is also phosphorylated by CDK2/ cyclin E in vitro [20] This dynamic interaction greatly stimulated the activity of CDK2/ cyclin E toward phosphorylation of CTD in vitro [20] In. .. Tat is phosphorylated by CDK2 in vitro and Ser-16 and Ser-46 residues of Tat are potential phosphorylation sites We previously showed that Tat is phosphorylated by recombinant CDK2/ cyclin E in
Ngày đăng: 13/08/2014, 09:20
Xem thêm: Báo cáo y học: " Phosphorylation of HIV-1 Tat by CDK2 in HIV-1 transcription" ppt, Báo cáo y học: " Phosphorylation of HIV-1 Tat by CDK2 in HIV-1 transcription" ppt