Research on a novel buck boost converter for wind turbine systems

Research on a novel buck boost converter for wind turbine systems

Research on a novel buck boost converter for wind turbine systems

... above and below the output ac voltage, thus demanding a buck- boost operation of converters. Many traditional full-bridge buck converters, two-stage converters and single-stage buck- boost converters ... Abstract For converter- based wind turbine systems in grid-connected applications as distributed generators (DG), variable sources often cause wide changes in the conv...

Ngày tải lên: 03/01/2014, 19:16

6 418 0
DC bus control of variable speed wind turbine using a buck boost converter

DC bus control of variable speed wind turbine using a buck boost converter

... maximum at a specific value of it is apparent that, when operating at a constant speed, the power coefficient will be maximum at only one wind speed. DC Bus Control of Variable Speed Wind ... gives the schematic diagram of the stand-alone wind energy system under consideration. A three-phase PMSG is connected to a DC battery bank via a rectifier. The DC/DC converter...

Ngày tải lên: 03/01/2014, 19:15

5 576 1
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

... 277 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... Grant-in-Aid for Exploratory Research from the Japan Society for the Promotion of Science and a special Grant-in-Aid of the Advanced Program of High Profile Research for Aca...

Ngày tải lên: 18/02/2014, 08:20

14 617 0
Tài liệu Báo cáo khoa học: TransLISA, a novel quantitative, nonradioactive assay for transcription factor DNA-binding analyses pdf

Tài liệu Báo cáo khoa học: TransLISA, a novel quantitative, nonradioactive assay for transcription factor DNA-binding analyses pdf

... TransLISA, a novel quantitative, nonradioactive assay for transcription factor DNA-binding analyses Kristiina A. Vuori 1 , Johanna K. Ahlskog 2 , Lea Sistonen 2 and Mikko Nikinmaa 1 1 Centre ... min PAGE Pipet to plate, add A beads and incubate +16 h D 1 h Autoradiography Add D beads and incubate D A O 2 Read AlphaLISA si g nal at 615 nm HSE Fig. 1. Comparison of EMSA and TransLISA...

Ngày tải lên: 18/02/2014, 14:20

9 457 0
Báo cáo khoa học: "A Novel Word Segmentation Approach for Written Languages with Word Boundary Markers" pptx

Báo cáo khoa học: "A Novel Word Segmentation Approach for Written Languages with Word Boundary Markers" pptx

... intentional or un-intentional spacing errors; and even a few spacing errors can cause error-propagation for further NLP stages. For written languages that have WBMs, such as for the Korean language, ... language, the majority of recent research has been based on a traditional WS ap- proach (Nakagawa, 2004). The first step of the traditional approach is to eliminate all spaces in...

Ngày tải lên: 17/03/2014, 02:20

4 268 0
THE AFTERLIVES OF COURSES ON THE NETWORK: INFORMATION MANAGEMENT ISSUES FOR LEARNING MANAGEMENT SYSTEMS pptx

THE AFTERLIVES OF COURSES ON THE NETWORK: INFORMATION MANAGEMENT ISSUES FOR LEARNING MANAGEMENT SYSTEMS pptx

... records for a host of reasons: grade appeals, teaching portfolios, learning materials, preparation of new classes, or the advance of scholarly communication, to name only a few. The ramifications ... LMS facilitates and captures communication as new digital content and also provides tools for the aggregation, organization, and annotation of content from a multiplicity of sources...

Ngày tải lên: 17/03/2014, 20:20

14 362 0
Toward Sustainability A Plan for Collaborative Research on Agriculture and Natural Resource Management potx

Toward Sustainability A Plan for Collaborative Research on Agriculture and Natural Resource Management potx

... Sustainability: A Plan for Collaborative Research on Agriculture and Natural Resource Management http://www.nap.edu/catalog/1822.html Toward Sustainability A Plan for Collaborative Research on Agriculture and ... Agriculture and Natural Resource Management Panel for Collaborative Research Support for AID's Sustainable Agriculture and Natural Resource Management Prog...

Ngày tải lên: 06/03/2014, 15:20

163 402 0
Review of the Need for a Large- scale Test Facility for Research on the Effects of Extreme Winds on Structures pptx

Review of the Need for a Large- scale Test Facility for Research on the Effects of Extreme Winds on Structures pptx

... operations. Finally there is no guarantee that federal funds would be made available on an ongoing basis to support research at an LSWTF even if a national wind- hazard reduction program were established. The ... perform experiments under controlled and repeatable conditions —an option not readily available in experiments with natural wind. In addition, an LSWTF has the potential, as...

Ngày tải lên: 08/03/2014, 19:20

49 588 0
QUALITATIVE RESEARCH FOR IMPROVED HEALTH PROGRAMS: A Guide to Manuals for Qualitative and Participatory Research on Child Health, Nutrition, and Reproductive Health doc

QUALITATIVE RESEARCH FOR IMPROVED HEALTH PROGRAMS: A Guide to Manuals for Qualitative and Participatory Research on Child Health, Nutrition, and Reproductive Health doc

... short training course. It is one of the few manuals on qualitative research available in both French and Spanish. The RAP Manual is also valuable as a companion to the manuals on specific health ... (AED) USAID, Bureau for Africa, Office of Sustainable Development QUALITATIVE RESEARCH FOR IMPROVED HEALTH PROGRAMS: A Guide to Manuals for Qualitative and Participatory Researc...

Ngày tải lên: 23/03/2014, 06:20

194 446 1
Báo cáo khoa học: and protein bilinear indices – novel bio-macromolecular descriptors for protein research: I. Predicting protein stability effects of a complete set of alanine substitutions in the Arc repressor ppt

Báo cáo khoa học: and protein bilinear indices – novel bio-macromolecular descriptors for protein research: I. Predicting protein stability effects of a complete set of alanine substitutions in the Arc repressor ppt

... different purposes. When a mathematical invariant is calculated from a specific representation scheme, only a partial character- ization from the chemical structure can be achieved because only a part of the chemical ... Marrero-Ponce Y, Castillo-Garit JA, Olazabal E, Serrano HS, Morales A, Castanedo N, Ibarra-Velarde F, Huesca-Guillen A, Jorge E, del Valle A et al. (2004) TOMOCOMD...

Ngày tải lên: 29/03/2014, 09:20

29 406 0
w