nanoparticle a novel lipid based vector for liver gene transfer

... uniform and non-uniform arrangements In ref [20], different types of array structures for smart antennas (ULA, UCA and Uniform Rectangular Array (URA)), AOA estimation and beamforming performance ... directions and comparison of the array configurations (ULA, PA, L-shape and V-shape arrays) in AOA estimation performance, estimation accuracy as well as resolution, and also their computational complexity ... shape and V-shape arrays, are applied for 1-D AOA estimation and their performance is compared with the PA In the literature, planar L-shape array has shown good accuracy [13] and the V-shape structure...

Ngày tải lên: 21/06/2014, 01:20

... graph as ACO-MGA algorithm does but with more efficient heuristic information and local search procedures General framework of ACO-MGA2 is as follows A General framework After initializing parameters ... initialize pheromone trail matrix and m ants; while (stop conditions not satisfied) for each a ∈ A Ant a build a multiple graph alignment; Local search// run only at the second stage Search by changing ... vertices Random walk procedure to construct an alignment In each iteration, each ant will repeat the process to build vectors a = (a1 ,…, an) for an alignment A as follows The ant randomly chooses an...

Ngày tải lên: 14/10/2015, 15:23

... and (D) annexin A1 The migration positions of molecular mass standards and protein loading amounts are indicated IEF ⁄ SDS ⁄ PAGE -based investigation, a commercially available colloidal Coomassie ... database (release 48.8) with fixed carbamidomethyl modification of cysteine residues, variable oxidation of methionine and variable deamidation of asparagine and glutamine Parent and fragment mass ... Kristiansen TZ, Jonnalagadda CK, Surendranath V, Niranjan V, Muthusamy B, Gandhi TK, Gronborg M et al (2003) Development of human protein reference database as an initial platform for approaching systems...

Ngày tải lên: 07/03/2014, 06:20

... moving average method (Vlachos The news articles in one day is treated as a batch 44 et al., 2004) ,we parameterize p0 and p1 with the time index for each batch, formally, we have p0 (t) and p1 ... frequency state q1 Each state has its own emission rate (p0 and p1 respectively), and there is a probability for changing state If an interval of high states appears in the optimal state sequence ... “relevant” documents by systems We use average precision, average recall and mean average precision(MAP) as evaluation metrics A difference is that we not have queries, and the output of a system...

Ngày tải lên: 23/03/2014, 14:20

... the optimal locations for sensors In addition, processing algorithms for extraction of patterns from gathered data are required, as well as wearable and wireless hardware to allow the data to be ... electroactive polymers are attractive for sensing in a garment-integrated context because of their ability to retain the tactile and mechanical properties of a textile -based structure In the garment ... organization and supervised the research All authors read and approved the final manuscript Acknowledgements This material is based on works supported by Science Foundation Ireland under Grant...

Ngày tải lên: 19/06/2014, 10:20

... correlated fading, in IEEE VTC 3, 2050–2054 (1997) 27 A Akansu, M Tazebay, M Medley, P Das, Wavelet and subband transforms: fundamentals and communication applications IEEE Communications Magazine ... partitioning of PO-CI and odd/even separation of available subcarriers are useful in adding extra users and hence the system capacity In multimedia communication, users transmit at variable data ... CI/MC-CDMA with variable data rates Although the system capacity has been increased up to three times (i.e., system capacity 3N), higher BER restricts real-time data communication This paper attempts...

Ngày tải lên: 20/06/2014, 22:20

... allocation scheme is used as the channel state information (CSI) is not available at the transmitter If the average attenuation of the channel for each cooperative node pair can be estimated, ... perform data aggregation to remove the redundancy in the data After aggregating received data frames, the cluster head will forward the data packet to the TCH by multiple hops routing In each ... be a cluster head with a probability p as specified in the original LEACH protocol After the cluster heads are elected, each cluster head will broadcast an advertisement message (ADV) by transmit...

Ngày tải lên: 22/06/2014, 22:20

... same scene at approximately the same camera orientation A security goal of each node in a cluster is to send partial visual information, which we call shares to a base station or multiple base ... offers a general paradigm for creating shares in a VSN, and hence many algorithms can be created based on the same principles The use of dynamic system theory for this purpose is novel and, as we ... provides a framework for generating the shares that drive an initial state to a desired state for nonlinear dynamical systems in general We first review Lyapunov stability theory The equilibria of a...

Ngày tải lên: 22/06/2014, 23:20

... 1-O-(6’-aminohexyl)-D-galactopyranoside AMC Academic Medical Center ALF Acute liver failure ALT Alanine Transaminase APAP Acetaminophen ASGPR Asialoglycoprotein Receptor BC Bile Canaliculi BLAD Bio-artificial liver ... separated from plasma by the capillary membranes Before entering the bioreactor, the plasma passes a charcoal absorber for detoxification and a membrane oxygenator for oxygen enrichment The ELAD ... biomaterials conjugated with galactose ligands such as PET, PVDF and PCL and have been applied for BLAD with optimal performances [81] Several strategies have been applied to fabricate substrata...

Ngày tải lên: 12/09/2015, 08:19

... inverters can accommodate a wide range of input dc voltage for an improved energy output from variable wind turbine resources The input source and the output grid are separated based on flyback operation ... energy exchange and transfer in Mode can be also applied to Mode As a result, in the NHC of ac output, the energy is transferred from dc source to ac grid through L1, L2 and C by the alternations ... (DCM); the averaged current of Mode is the average output current of the inverter and can be expressed as, 230 vc is the capacitor voltage and is in the same order as the grid voltage The voltage stresses...

Ngày tải lên: 03/01/2014, 19:16

... 277 283 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK *****::*.** : ... Toyobo (Osaka, Japan) Emulgen 911 was a gift from Kao Chemical (Tokyo, Japan) NADPH, NADH and NADP+ were purchased from Oriental Yeast (Tokyo, Japan) a- Cyano-4-hydroxycinnamic acid was obtained from ... :.:: : * : * NAYTAKAVIIAAGVGAFEPRRIGAPGEREFEGRGVYYAVKSKA-EFQGK-RVLIVGGGDS -EYTCDALIIATGASA -RYLGLPSEEAFKGRGVSACATCDG-FFYRNQKVAVIGGGNT LEVKARTVILAVGSRR -RKLGVPGEAELAGRGVSYCSVCDAPLFKGKDAVVVVGGGDS...

Ngày tải lên: 18/02/2014, 08:20

... Biotin-TCGACTAGAAGCTTCTAGAAGCTTCTAG AGCTGATCTTCGAAGATCTTCGAAGAT Biotin-TCGACTTCAAGCTTGTACAAGCTTGTAG AGCTGAAGTTCGAACATGTTCGAACATC Biotin-AACGACGGTCGCTCCGCCTGGCT nM Unlabeled HSE DNA-binding activity ... Incubation 1.5 mL tube 30 Pipet to plate, add A beads and incubate PAGE Autoradiography A + 2h D +16 h 1h Add D beads and incubate O2 D A Read AlphaLISA signal at 615 nm Fig Comparison of EMSA and ... confirm that the assay specifically measures HSF1 DNA-binding activity Analytical range and precision The analytical range of the assay was evaluated using known concentrations of recombinant human HSF1...

Ngày tải lên: 18/02/2014, 14:20

... therefore reasonable to conclude that kernel -based especially tree-kernel approaches are not suitable for Chinese, at least at current stage In this paper, we study a feature -based approach that ... Feature Space for Relation Extraction In proceedings of NAACL/HLT, pages 113-120 Nanda Kambhatla 2004 Combining Lexical, Syntactic, and Semantic Features with Maximum Entropy Models for Extracting ... three coarser structures , i.e nested, adjacent and separated, are used as feature, and a classifier is trained for each relation type and subtype; (2) similar to (1) but all nine structures are...

Ngày tải lên: 20/02/2014, 09:20

Ngày tải lên: 09/03/2014, 01:20

... L9 [2] H Sahaf, L Masson, C Leandri, B Auffray, G Le Lay, F Ronci, Appl Phys Lett 90 (2007) 263110 [3] M .A Valbuena, J Avila, M.E Davila, C Leandri, B Aufray, G Le Lay, M.C Asensio, Appl Surf ... filled states STM images of the surface following the evaporation of Å of THAP are displayed in Fig 3a and b Each molecule appears as a six-pronged shape with six bright lobes and a dark center ... structure as that observed upon adsorption on a clean Ag(1 0) surface [10] The reactivity of the Ag surface is presumably locally modified by the SiNWs, possibly by the formation a 2D surface Si–Ag alloy,...

Ngày tải lên: 16/03/2014, 15:35

... data Since the test data tend to have a similar error rate to the narrow standard deviation, we computed the overall performance over the average word spacing error rate, which is 9.1% The baseline ... spacing state for ot where ≤ t ≤ n Assume that xt is either (space after ot ) or (no space after ot ) Then each best word spacing state xt for all t can be found by ˆ using Equation xt ˆ = argmax ... 1998-1999 (1,000,000 Korean sentences) for the training data, and ETRI corpus (30,000 sentences) for the test data (ETRI, 1999) To generate the test data that have spacing errors, we make twenty one copies...

Ngày tải lên: 17/03/2014, 02:20

... Southern California Kenji Yamada and Kevin Knight 2001 A syntax -based statistical translation model In Proceedings of the 39th Annual Meeting of the ACL, pages 523–530 Philipp Koehn 200 4a Pharaoh: a ... Byrne 2005 A weighted finite state transducer translation template model for statistical machine translation Natural Language Engineering To appear 270 Ying Zhang, Stephan Vogel, and Alex Waibel 2004 ... grammar (defined below) A move to synchronous CFG can be seen as a move towards syntax -based MT; however, we make a distinction here between formally syntax -based and linguistically syntax-based...

Ngày tải lên: 17/03/2014, 05:20

... prepared by Tom Keenan 6The average length of a word in our Chinese data was 1.60 characters AB xB Ay ABC JAB JAB ABK AB~K xA y xAB y xABC y Rule ¢==~ ¢=:¢, ~ ~ ~ ~ ~ A x A A B B y B C JAB -~JA ... segmentation can easily be cast as a transformation -based problem, which requires an initial model, a goal state into which we wish to transform the initial model (the "gold standard"), and a series ... weakly statistical, but not probabilistic; transformation -based approaches conseo,:~,tly require far less training data than most o ;a~ is~ical approaches It is rule -based, but relies on 2See, for...

Ngày tải lên: 17/03/2014, 23:20

... Newly-planted and fast-growing forests in Asia and South America have turned cheap wood raw material to their advantage, and the pulp and paper business has become more global than ever (Haase S ... possible for e.g company management to define importance for areas and for e.g expert panels to evaluate specific areas This approach also balances the areas of the framework Using this separation, ... AGQA AHP BAT BC BHKP BNQP Activity Based Costing Approach-Deployment-Learning-Integration Arizona Governor’s Quality Award Analytic Hierarchy Process Best Available Technique Benefit-Cost analysis...

Ngày tải lên: 18/03/2014, 02:20

... pellets with a radioactive photoactivatable cholesterol analogue and analyzed the incorporation rates of the cholesterol probe The data suggest that the novel CHAPSTEROL is an appropriate detergent ... vials and made transparent with 10 mL of filtersafe (Zinsser Analytic, Frankfurt, Germany) 809 A novel cholesterol -based detergent Radioactivity was measured in a LKB 1215 Rackbeta liquid scintillation ... using aida (advanced image data analyzer, version 3.50, Raytest, Straubenhardt, Germany) Cholesterol was assayed spectrophotometrically using the cholesterol oxidase -based cholesterol diagnostic...

Ngày tải lên: 23/03/2014, 13:20