Optimization of 293 HEK suspension cultures for adenovirus production
... Fed-batch Cultures 64 4.4 293- HEK Cell Growth in Batch and Fed-batch Cultures 54 Conclusions 65 PROTEIN-FREE CHEMICALLY DEFINED MEDIUM FOR 293- HEK CELL GROWTH AND ADENOVIRUS PRODUCTION ... to grow in suspension and serum-free medium over a course of 3-4 weeks before analysis 117 Figure 7.3 Viable cell concentration profiles of suspension 293- HEK( control) cells (...
Ngày tải lên: 15/09/2015, 17:09
... rate constants of enzyme substrate (or protein–ligand) interactions from rapid reaction kinetic data J Biol Chem 250, 404 8–4 052 Fang J, Sawa T, Akaike T, Akuta T, Sahoo SK, Khaled G, Hamada A ... have proposed the use of d-amino acid oxidase (DAAO) from Rhodotorula gracilis (EC 1.4.3.3) for cancer treatment [11] Subsequently, the strategy for cancer therapy based o...
Ngày tải lên: 16/03/2014, 02:20
... synthesis enhanced by T7 RNA polymerase Prior to the preparation of 15N-labelled samples of hCypA and analysis by NMR spectroscopy, the performance of the cell-free expression system was explored ... 2004 Cell-free synthesis of 15 N-labelled proteins (Eur J Biochem 271) 4087 Optimization of other conditions for in vitro protein synthesis Fig Cell-free...
Ngày tải lên: 16/03/2014, 18:20
Báo cáo khoa học: "Optimization of the Agar-gel Method for Isolation of Migrating Ascaris suum Larvae From the Liver and Lungs of Pigs" pptx
... and standardize the agar-gel method for fast and reliable isolation of migrating A suum larvae from pig livers and lungs Materials and methods Experimental pigs Twenty-four crossbred Danish Landrace/Yorkshire/Duroc ... Watson 1973) The present results recommend a standardization of the agar-gel method for recovering of A suum larvae from pig l...
Ngày tải lên: 12/08/2014, 15:20
Optimization of solar thermal collector systems for the tropics
... Finally solar thermal system utilizes solar radiation to produce heat energy that involves the use of solar thermal collectors The present study focuses on this solar thermal system, especially on the ... payback period For the optimization of collector orientation, i.e., optimization of the azimuth φ and tilt angle β of the collector, the geograph...
Ngày tải lên: 02/10/2015, 15:50
Preparation, characterization and application of heterogeneous solid base catalyst for biodiesel production from soybean oil
... performances of these acid catalysts are still inferior compared with the base catalysts For this reason, a wide variety of solid bases have been examined for transesterification reactions for biodiesel ... of used vegetable oils using the heterogeneous WO3/ZrO2 catalyst for production of biodiesel Bioresour Technol 2010;101:S59e61 [10] Lou WY, Zong MH, Duan ZQ Ef...
Ngày tải lên: 05/05/2014, 08:42
Báo cáo sinh học: "Selection response of growth rate in rabbits for meat production" pptx
... INTRODUCTION Most breeding schemes concerning rabbits for meat production involve a specialized sire line selected exclusively on growth rate and or dam lines in which litter ... Direct responses for YVG were significant and positive in both lines Line B showed a higher rate of improvement per generation (2.0% of the base population mean in line B and 1.6% in line R)...
Ngày tải lên: 14/08/2014, 20:20
Advantages and challenges of the spray drying technology for the production of pure drug particles and drug loaded polymeric carriers
... ACCEPTED MANUSCRIPT Advantages and challenges of the spray- drying technology for the PT production of pure drug particles and drug- loaded polymeric carriers SC RI Alejandro Sosnik1* and Katia P Seremeta2,3,4 ... advantages and challenges of the spray- drying method for the production of pure drug particles and drug- load...
Ngày tải lên: 02/09/2015, 13:31
Báo cáo hóa học: " Optimization of capsid-incorporated antigens for a novel adenovirus vaccine approach" doc
... NSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAA SGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQ SNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQPEVEK GGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQ ... CGGGATCCCGGTTTCTTCTGAGGCTTCTCG CGGGATCCGGTGGCGCAGGCGG 83RGD -(as) 83RGD - (a) CGGGATCCCAGGGGTTTGATCACCGGTTT CGGGATCCACCGAACAGGGCGGGG 3'HVR5-(as) 5'HVR2-(s) GGCATGTAA...
Ngày tải lên: 20/06/2014, 01:20
BT 3 optimization of medium for indole 3 acetic acid production using pantoea agglomerans strain PVM
... Biosynthesis of indole -3- acetic acid (a) Enterobacter sp DHM-1T (FJ74 530 0·1) Enterobacter sp R4M-Q (GQ478271·1) Pantoea agglomerans strain P29 (DQ3569 03 1) Pantoea agglomerans strain PVM (GU929212·1) Pantoea ... concerned with the IAA production potential of P agglomerans strain PVM, optimization of 1240 medium components and in vitro root induction...
Ngày tải lên: 06/08/2013, 21:06
CFD for hydrodynamic efficiency and design optimization of key elements of SHP
... utility of the CFD numerical simulations as a tool for design and optimization of hydropower performance and flow behavior through hydromechanical devices or hydraulic structures of intake and outlet ... out of the best efficiency point (BEP) Figure Change of the runner speed and the frequency of vortex at the draft tube of a Francis turbine One of the most i...
Ngày tải lên: 05/09/2013, 14:58
Hamilton–Jacobi–Bellman equations and dynamic programming for power-optimization of radiative law multistage heat engine system
... 100 of heat engines are shown with the step of in Figures 7-9 Table lists optimization results of the key parameters of the multistage endoreversible heat engine system with the radiative heat ... Wi of each stage heat engine versus the stage i for Newtonian heat transfer law (fixed T1 f ) Table Optimization results of the key parameters of the multistag...
Ngày tải lên: 05/09/2013, 15:28
Numerical simulation and optimization of CO2 sequestration in saline aquifers for enhanced storage capacity and secured sequestration
... Algorithms in Search, Optimization & Machine Learning AddisonWesley, Boston, 1989 Zhang Z., Agarwal R.K Numerical Simulation and Optimization of CO2 Sequestration in Saline Aquifers for Vertical and ... [4] Zhang Z., Agarwal R.K Numerical Simulation and Optimization of CO2 Sequestration in Saline Aquifers in: Proceedings of 10th Annual Confer...
Ngày tải lên: 05/09/2013, 16:10
Tài liệu Analytical Measurement Solutions for Optimization of your Brewing Process pot
... automation of beverage plants through its offering of process analytical instrumentation, particularly outstanding for: • accuracy and reliability • high level of user-friendliness optimizing your process ... reliability of the measuring point INGOLD stands for technological, high-quality measurement solutions tailored to specific applications in the area of process...
Ngày tải lên: 22/02/2014, 05:20
Báo cáo khoa học: "Efficient Optimization of an MDL-Inspired Objective Function for Unsupervised Part-of-Speech Tagging" docx
... perform this optimization for each instance of (15) These optimizations could easily be performed in parallel for greater scalability (13) subject to the constraints w P(w | t) = and ... non-convex optimization problem for which we invoke a publicly available constrained optimization tool, ALGENCAN (Andreani et al., 2007) To carry out its optimization, ALGENCAN re...
Ngày tải lên: 07/03/2014, 22:20