Functional effects of a novel BIM deletion polymorphism in mediating resistance to tyrosine kinase inhibitors in cancer
... consist of an extracellular domain that contains a ligand-binding site, a transmembrane helix and a cytoplasmic domain The cytoplasmic domain contains a kinase active site that catalyzes tyrosine ... that the SH3 domain of ABL1 is able to participate in intramolecular interactions to inhibit ABL1’s kinase activity9 Apart from intramolecular interactions, the kinase a...
Ngày tải lên: 10/09/2015, 09:04
... [pii] Purandare AV, Chen Z, Huynh T, Pang S, Geng J, Vaccaro W, Poss MA, Oconnell J, Nowak K & Jayaraman L (2008) Pyrazole inhibitors of coactivator associated arginine methyltransferase (CARM1) ... were all effective methyltransferase inhibitors Only AMI-1 and AMI-6 demonstrated selectivity for the PRMTs, although AMI-6 was minimally active against a cellular PRMT substrate [8] Com...
Ngày tải lên: 06/03/2014, 11:20
... sequence VBARP-L 1.9 VBARP-S 1.3 AACAATGCTGACTGATAGCGGAGGA (Forward) TAAGCTACTACGTAAAGAATATATC (Reverse) GATAAGGTACCTGCACTGACACGGATGAAAGC (Forward) CATATATTCTTTACGTAGTAGCTTA (Reverse) FEBS Journal 272 ... identified and functionally characterized VBARP, a novel splice variant of ANKHD1 Human ANKHD1 gene is a large transcript containing multiple ankyrin repeat motif domains a...
Ngày tải lên: 07/03/2014, 21:20
Báo cáo khoa học: Identification and functional characterization of a novel barnacle cement protein pptx
... VPPPCDFSIKSKQKQVGVTAGGASVSAKGATSGSGSITCITKTPTSVTKKVAAGNAGVSG Mrcp19k Bacp19k Bicp19k 70 80 90 100 110 120 TSVSAGDGAFGNLAAALTLVEDTEDGLGVKTKNGGKGFSEGTAAISQTAGANGGATVKKA VSASAANGFFKNLGKATTEVKTTKDGTKVKTKTAGKGKTGGTATTIQIADANGGVSEKSL AAAAAGNGVFKNLVTALTNISTTDDITKVQTQTIGSGGTGGAATILQLADANGGAALKEV ... underwater material surfaces was analyzed by: (a) quantitative amino acid analysis; and (b) SPR Pro...
Ngày tải lên: 16/03/2014, 05:20
Báo cáo y học: "Demonstration of the histopathological and immunohistochemical effects of a novel hemostatic agent, ankaferd blood stopper, on vascular tissue in a rat aortic bleeding mode" pps
... experimental study, we investigated the effects of ABS on vascular tissue in a rat model of aortic bleeding Methods Wistar albino (WA) rats were used to demonstrate the vascular histopathological and immunohistochemical ... with the “Principles of Laboratory Animal Care” formulated by the National Society for Medical Reseacrh and “Guide for the Care...
Ngày tải lên: 10/08/2014, 09:22
Genomic organization and functional characterization of a novel cancer associated gene u0 44
... Northern, Cancer Profiling Array and Cancer Cell Line Profiling Array 3.9 Semi-quantitative RT-PCR of Human and Rat UO -44 3.10 Quantitative (Real-time) PCR of UO -44 3.11 Generation and Transfection ... Molecular Cloning and Characterization of a Putative Oncogene, HuUO -44, in Human Ovarian Carcinogenesis Awarded AVON international scholar-in-training award poster pr...
Ngày tải lên: 14/09/2015, 21:59
Tài liệu Báo cáo khoa học: Identification of a novel matrix protein contained in a protein aggregate associated with collagen in fish otoliths pdf
... aragonite crystals [4–7] We therefore examined proteins contained in aggregates within the otolith matrix and identified a protein contained in the HMW protein glycosaminoglycan aggregate that also ... digestion of genomic DNA contamination in the total RNA was confirmed by lack of amplification of a b-actin mRNA fragment by PCR using a pair of primers (5¢-ATCACCAT...
Ngày tải lên: 18/02/2014, 17:20
Tài liệu Báo cáo khoa học: Functional effects of deleting the coiled-coil motif in Escherichia coli elongation factor Ts pptx
... reaction in EF-Tu was investigated by studying the functional effects of deleting the motif in EF -Ts, both in vivo and in vitro The motif was deleted in endogenous EF -Ts in E coli strain UY211 ... pMAK705-d.tsf, used for the deletion of the coiled-coil motif (cc) of endogenous EF -Ts The plasmid contains an 1148-bp insert in which the regi...
Ngày tải lên: 21/02/2014, 00:20
Báo cáo lâm nghiệp: "Effects of a clear-cut on the in situ nitrogen mineralisation and the nitrogen cycle in a 67-year-old Douglas-fir (Pseudotsuga menziesii (Mirb.) Franco) plantation" potx
... lower than mineralisation Mineralisation and root uptake were generally lower during the winter season, but the dormant season is probably shorter than months, and a part of the calculated fluxes ... Pietikọinen and Fritze [63] measured no increase in nitrification in non-nitrifying soil, although mineralisation increased Finally, Barg and Edmonds [4] found no change...
Ngày tải lên: 08/08/2014, 01:21
Báo cáo khoa học: "Identification of a novel germ-line mutation in the TP53 gene in a Mexican family with Li-Fraumeni syndrome" doc
... genetic counseling and possibly clinical management Patients and Methods Family The family studied is of Mexican origin The index case was a 23-year-old female diagnosed with breast carcinoma ... carcinoma of the left breast with combined histological features of lobular carcinoma and infiltrating ductal carcinoma The family history suggested LFS: the patient's f...
Ngày tải lên: 09/08/2014, 04:21
Báo cáo y học: "Chemokine receptor expression and functional effects of chemokines on B cells: implication in the pathogenesis of rheumatoid arthritis" ppt
... expression < /b> Finally, we examined the effects < /b> of < /b> the chemokines < /b> on < /b> the expression < /b> of < /b> the cell surface molecules ICOSL, BAFF-R and < /b> TACI by peripheral blood B cells of < /b> normal donors and < /b> sub- Page of < /b> 11 ... chemokine receptor < /b> expression < /b> by peripheral blood in both normal donors and < /b> subject...
Ngày tải lên: 09/08/2014, 14:22
báo cáo khoa học: " A radiographic analysis of tooth morphology following the use of a novel cyclical force device in orthodontics Chung H Kau" pps
... mouse and houses the mechanical, electrical, and energy components to activate the mechanical force from the post The patient places and activates the device once daily for 20 The applied force ... optimal force varies between patients along with the magnitude of the applied force affecting the rate of tooth movement [2] Therefore, a device that transmits...
Ngày tải lên: 11/08/2014, 20:21
TARGETING ACUTE PHOSPHATASE PTEN INHIBITION AND INVESTIGATION OF A NOVEL COMBINATION TREATMENT WITH SCHWANN CELL TRANSPLANTATION TO PROMOTE SPINAL CORD INJURY REPAIR IN RATS
... remembered and appreciated iii ABSTRACT Chandler L Walker TARGETING ACUTE PHOSPHATASE PTEN INHIBITION AND INVESTIGATION OF A NOVEL COMBINATION TREATMENT WITH SCHWANN CELL TRANSPLANTATION TO PROMOTE SPINAL ... downstream Akt and mTOR signaling promotes programmed cell death i.e apoptosis and autophagy PI3K = Phosphatidylinositol 3-Kinase; PTEN =...
Ngày tải lên: 24/08/2014, 09:14
Identification and characterization of a novel heart reactive autoantibody in systemic lupus erythematosus possible serological marker for early myocardial dysfunction
... overall incidence was found in Iceland and Japan and highest in USA and France The overall prevalence was the lowest in Northern Ireland, UK and Finland, and the highest in Italy, Spain and Martinique ... IDENTIFICATION AND CHARACTERIZATION OF A NOVEL HEART- REACTIVE AUTOANTIBODY IN SYSTEMIC LUPUS ERYTHEMATOSUS: POSSIBLE SEROLOGICAL MARKER FO...
Ngày tải lên: 14/09/2015, 12:42
Cloning and characterization of a novel kelch like gene in zebrafish
... and Talbot, 1997) The two main approaches of cloning mutated genes, positional cloning and candidate gene approach, have benefited greatly from the recent advances in zebrafish genomic infrastructure ... represents just the data acquisition phase Faced with an avalanche of sequence data, researchers are now faced with the daunting task of deciphering and interpreting the...
Ngày tải lên: 03/10/2015, 20:57