CO2 emission optimization for a blast furnace considering plastic injection

... heat demand for desulfurization heat demand for carbonate decomposition physical heat of slag physical heat of hot metal physical heat of blast furnace gas heat demand for evaporation of water ... heat demand of carbonate decomposition, physical heat of slag, physical heat of hot metal, physical heat of blast furnace gas, heat demand of evaporation of water in raw materials and...

Ngày tải lên: 09/09/2015, 10:17

... Yang B, Sun F Exergoeconomic performance optimization of an endoreversible intercooled regenerated Brayton cogeneration plant Part 1: thermodynamic model and parameter analyses Int J Energy and ... (21) are the finite time exergoeconomic performance characteristic of the endoreversible Carnot refrigeration cycle [31, 38] Equations (15) and (21) are the major performance re...

Ngày tải lên: 05/09/2013, 17:08

... NSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAA SGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQ SNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQPEVEK GGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQ ... CGGGATCCCGGTTTCTTCTGAGGCTTCTCG CGGGATCCGGTGGCGCAGGCGG 83RGD -(as) 83RGD - (a) CGGGATCCCAGGGGTTTGATCACCGGTTT CGGGATCCACCGAACAGGGCGGGG 3'HVR5-(as) 5'HVR2-(s) GGCATGTAA...

Ngày tải lên: 20/06/2014, 01:20

... DFT -precoding to be applied to uplink multiuser MIMO OFDM systems as a means to reduce the PAPR of the transmit waveform For practical interest, we assume that a simple linear zero forcing (ZF) MIMO ... linear precoder represent two spatial data streams, each of which is processed at one antenna by a Q point IDFT and cyclic prefix is inserted (CP -OFDM) We assume that the...

Ngày tải lên: 21/06/2014, 05:20

... constraints for the expectation method Final Remarks In this paper, a class of stochastic bi-criteria optimization problems was studied by a new hybrid method where the chance-constrained programming ... objective achieve its maximal value Next, taking into account that the expectation value represents the average level and the variance indicates the deviation of the...

Ngày tải lên: 21/06/2014, 07:20

... Ogura, Y Yamashita, and K Sakaniwa, Quadratic optimization of fixed points of nonexpansive mappings in Hilbert space, Numer Funct Anal Optim 19 (1998), no 1-2, 165–190 D C Youla, Mathematical theory ... S Atsushiba and W Takahashi, Strong convergence theorems for a finite family of nonexpansive mappings and applications, Indian J Math 41 (1999), no 3, 435–453 H H B...

Ngày tải lên: 23/06/2014, 00:20

Ngày tải lên: 08/08/2012, 17:20

Ngày tải lên: 04/10/2012, 10:02

... dollars in research funding, diarrhoea 60 million dollars in research funding, malaria 50 million dollars and TB 20 million dollars in research funding In conclusion it is clear that funding allocation ... model answer: The graphs compare the number of deaths caused by six diseases in Someland in 1990 with the amount of research funding allocated to each of those diseases...

Ngày tải lên: 04/10/2012, 10:02

... situation had changed radically by 1995 In 1995, 90% of women in Someland had completed secondary education and of those, half had graduated from an initial degree and 20% had gone on to postgraduate ... postgraduate studies At the other end of the scale we can see that by 1995 all girls were completing lower secondary, although 10% ended their schooling at this point This is in sta...

Ngày tải lên: 04/10/2012, 10:02

... often have to draw on personal assets to finance the business, and these statements will show what is available Bankers and investors usually want this information as well Page 20 of 27 IX Startup ... reports that any business needs for reporting and financial management A balance sheet shows what items of value are held by the company (assets), and what its debts are (liabilities)...

Ngày tải lên: 23/10/2012, 15:46

... principles and applications in aerospace medicine Aviat Space Environ Med 2007, 78:973-978 Thibeault C, Evans A; Air Transport Medicine Committee, Aerospace Medical Association: Emergency medical kit for ... Critical Care Vol 13 No Ruskin aerospace medical researchers, and the traveling public Sand and colleagues’ study should serve as a template for future research in this impor...

Ngày tải lên: 25/10/2012, 10:06

... for the cytotoxicity assay RESULTS Clinical efficacy of WT1 peptide vaccination A 51 year-old male with CML in chronic phase had been treated with 400 mg imatinib for two and a half years Although ... 40 6a 27 Oka Y, Tsuboi A, Murakami M, Hirai M, Tominaga N, Nakajima H, Elisseeva OA, Masuda T, Nakano A, Kawakami M, Oji Y, Ikegame K, Hosen N, Udaka K, Yasukawa...

Ngày tải lên: 26/10/2012, 09:39

... Representatives That Are A Perfect Fit Chapter Six Hiring Sales Managers That Are A Perfect Fit Chapter Seven Hiring Department Managers That Are A Perfect Fit Chapter Eight Hiring Executives That Are ... www.xbcoaching.com Chapter Seven Hiring Department Managers That Are A Perfect Fit © Kathi Graham-Leviss http://www.xbcoaching.com Regardless of the particular area of the co...

Ngày tải lên: 06/11/2012, 15:40

... advances and the reserve of the past calms her down Then they go, or at least they think so They head to the ocean and they leave The love agony was never a bearable landscape Never It hurts too ... inert And leaving is healthy, even with the rancor of dizziness In search of a nice awakening, painting that hair with silver color, still perfumed, dyeing that face with shadows, st...

Ngày tải lên: 07/11/2012, 09:09