Báo cáo y học: "GMODWeb: a web framework for the generic model organism database" pptx

Báo cáo y học: "GMODWeb: a web framework for the generic model organism database" pptx

Báo cáo y học: "GMODWeb: a web framework for the generic model organism database" pptx

... many of the data types needed for a model organism database. GMODWeb architecture GMODWeb is based on the Turnkey website generation and rendering framework [19]. Specifically, GMODWeb is a web- site ... MOD websites are released from a vari- ety of tasks that would normally slow a site's creation. These include the automatic generation of several web applicatio...

Ngày tải lên: 14/08/2014, 20:22

11 366 0
Báo cáo y học: "FusionSeq: a modular framework for finding gene fusions by analyzing paired-end RNA-sequencing data" pdf

Báo cáo y học: "FusionSeq: a modular framework for finding gene fusions by analyzing paired-end RNA-sequencing data" pdf

... 1 - TAGGCGC GAGCTAAGCAGGAG; reverse, ERG exon 5 - GTAGGCACACTCAAACAACGACTGG; as published by Tomlins et al. [23]) and 50 ng cDNA at an annealing temperature (Ta) of 63°C for 35 cycles and the ... helped analyze the data and drafted the manuscript. Additional material Additional file 1: Supplementary material, tables and figures .The results of different mapping tools and approaches,...

Ngày tải lên: 09/08/2014, 22:23

19 519 0
Báo cáo y học: "miRTRAP, a computational method for the systematic identification of miRNAs from high throughput sequencing data" pptx

Báo cáo y học: "miRTRAP, a computational method for the systematic identification of miRNAs from high throughput sequencing data" pptx

... apparent false negative rate of approxi- mately 5% and a false discovery rate of approximately 19%. To systematically compare the miRTRAP and miRDeep methods, we tested the new Ciona library data using ... S, Tomaru Y, Kasukawa T, Waki K, Nakanishi M, Nakamura M, Nishida H, Yap CC, Suzuki M, Kawai J, Suzuki H, Carninci P, Hayashizaki Y, Wells C, Frith M, Ravasi T, Pang KC, Hallinan...

Ngày tải lên: 09/08/2014, 20:21

12 553 0
Báo cáo y học: "ExpressionPlot: a web-based framework for analysis of RNA-Seq and microarray gene expression data" doc

Báo cáo y học: "ExpressionPlot: a web-based framework for analysis of RNA-Seq and microarray gene expression data" doc

... Access ExpressionPlot: a web- based framework for analysis of RNA-Seq and microarray gene expression data Brad A Friedman 1,2,3* and Tom Maniatis 4 Abstract RNA-Seq and microarray platforms have ... background-subtracted probe intensi- ties. Users can use any affymetrix array for which they have the appropriate library files, but for the following arrays those files can be au...

Ngày tải lên: 09/08/2014, 23:20

12 394 0
Báo cáo y học: "yrGATE: a web-based gene-structure annotation tool for the identification and dissemination of eukaryotic genes" pdf

Báo cáo y học: "yrGATE: a web-based gene-structure annotation tool for the identification and dissemination of eukaryotic genes" pdf

... 86853546,86854566 AGCACCGCGCAGGCGCTGCGGAGCCGCGCGGAGGAAGTTTGAACG GTGGCGGGTACCGGAGCCGCTGATGGAGTCCGTGCTGAAAGGTAT ATGTGCATTTGTAGAAGTTTGGTCATCTAGCAGAACAGAAAATTA CTCAAAAGCCTTTGAGCAGCAACTTCTTGATATGGGAGCAAAAGT TTCAAAAACTTTCAACAAGCGCGTGACACATGTAGTCTTCAAAGA TGGACATTCAACTACATGGAGAAAAGCACAGGATGCTGGTGTAAA MESVLKGICAFVEVWSSSRTENYSKAFEQQLLDMGAKVSKTFNKR VTHVVFKDGHSTTWRKAQDAGVKTVSVLWVEKCRETGVRVDESLF PAVYNNDGL...

Ngày tải lên: 14/08/2014, 16:21

11 467 0
Báo cáo y học: "GENECODIS: a web-based tool for finding significant concurrent annotations in gene lists" ppsx

Báo cáo y học: "GENECODIS: a web-based tool for finding significant concurrent annotations in gene lists" ppsx

... data can provide a basis for the characterization of unknown genes, and at the same time they are also the basis for elucidating the biological processes asso- ciated with the experimental system. ... current applications for functional pro- filing essentially use the same general approach and generate statistical scores for single annotations. They mainly differ on aspe...

Ngày tải lên: 14/08/2014, 17:22

8 270 0
Báo cáo khoa học: TICL – a web tool for network-based interpretation of compound lists inferred by high-throughput metabolomics doc

Báo cáo khoa học: TICL – a web tool for network-based interpretation of compound lists inferred by high-throughput metabolomics doc

... metabolic pathway. Another procedure (impact analysis) proposed recently by Draghici et al. [25,26] goes beyond gene pairs and fully captures the topology of signaling pathways by propagating the ... pathways and networks. Trends Biochem Sci 33, 101–103. 33 Okuda S, Yamada T, Hamajima M, Itoh M, Katayama T, Bork P, Goto S & Kanehisa M (2008) KEGG atlas mapping for global analysis of...

Ngày tải lên: 16/03/2014, 01:20

11 402 0
Báo cáo y học: "Deep transcranial magnetic stimulation for the treatment of auditory hallucinations: a preliminary open-label study" pptx

Báo cáo y học: "Deep transcranial magnetic stimulation for the treatment of auditory hallucinations: a preliminary open-label study" pptx

... Center and head of the electroconvulsive therapy unit of the Beer Ya’akov Mental Health Center. PD is paid by by Beer Ya’akov Mental Health Center. YR works as a research consultant for Brainsway. Competing ... Beer Ya’akov Mental Health Center and is paid by the research fund of the Beer Ya’akov Mental Health Center. KM serves as the director of the Beer Ya’akov Mental Health...

Ngày tải lên: 09/08/2014, 01:21

6 485 0
Báo cáo y học: "Urokinase, a constitutive component of the inflamed synovial fluid, induces arthritis" pps

Báo cáo y học: "Urokinase, a constitutive component of the inflamed synovial fluid, induces arthritis" pps

... levels in the plasma and synovial fluid samples as well as in various preparations of uPA were deter- mined as a total uPA antigen level, by a sandwich ELISA (Haemochrom Diagnostica GmBH, Mölndal, ... performed by several proteases including MMPs and plasmin, resulting in the release of the LMW- uPA molecule, and may serve as a feedback mechanism of the uPA-induced inflammation....

Ngày tải lên: 09/08/2014, 01:21

9 371 0
Báo cáo y học: "TWEAK: a novel biomarker for lupus nephritis" pot

Báo cáo y học: "TWEAK: a novel biomarker for lupus nephritis" pot

... inadequate because substantial renal tissue damage can occur before function is impaired to a detectable extent [4]. Renal biopsy remains the gold standard for assessment of LN disease activity. ... injury has anti- inflammatory effects [5]. In the current paper by Schwartz and colleagues, TWEAK was assessed as a biomarker for LN in both cross-sectional and longitudinal studies. I...

Ngày tải lên: 09/08/2014, 14:22

3 337 0
w