Label free and reagentless electrochemical detection of microRNAs using a conducting polymer nanostructured by carbon nanotubes application to prostate cancer biomarker mir 141

... 165 Label- free and reagentless electrochemical detection of microRNAs using a conducting polymer nanostructured by carbon nanotubes: Application to prostate cancer biomarker miR- 141 H.V. Tran a, b , ... Cai et al., 2003). In this paper, we describe a label- free and reagentless miRNA sensor based on an interpenetrated network of carbon...

Ngày tải lên: 02/07/2014, 14:14

... basic parts to the readily fabricated from off-the shelf materials that are reasonably stable, and its subse- quent application to simple and low-cost diagnostics. Optimization of heterolihanded ... the sensing analysis and drafted the manuscript. SL participated in the fabrication of the film. JY conceived of the study, and participated in its design and coordination. A...

Ngày tải lên: 21/06/2014, 04:20

... completed all of the extraction of total RNA from blood samples. BL provided project and sample management support. AL and MN completed the analysis of the SAHA data. MM assisted with the data analysis and ... probes generated by Ribo-SPIA amplification perform better than using the standard cRNA m ethod of amplification and labeling. cDNA hybridization s have greater inte...

Ngày tải lên: 18/06/2014, 16:20

...  1. Laila Impex R&D Center, Jawahar Autonagar, Vijayawada, 520 007, India 2. Department of Orthopedics, Alluri Sitarama Raju Academy of Medical Sciences (ASRAM), National Highway 5, Eluru, ... urine and whole blood of all subjects at each visit of the study duration. Serum biochemical parameters and hematological parameters were measured using an automated analyzer (...

Ngày tải lên: 25/10/2012, 11:40

... fi nancial deepening (measured by the ratio of fi nancial to real wealth) and in- creased fi nancial intermediation (measured by the share of fi nancial assets of fi nancial institutions in total ... economic organizations and also integrated areas of fi nan- cial activity earlier separated from one another to ensure transparency and discourage unsound fi nancial practices. 2...

Ngày tải lên: 23/12/2013, 13:15

... thermal infrared sixth band) and we analyzed several combinations of three bands. Among the possible combinations of Landsat bands, the most significant for our aims have been: 1. The bands 4, 5 and ... near Caserta (Italy), and the sp ecific goal was the discrimination and monitoring of caves and wasting areas present in the scene. In our case we use only six out of the seven...

Ngày tải lên: 16/01/2014, 16:33

... infection, as assessed by the mitochondrial release of cytochrome c, caspase-9 and caspase-3 activa- tion, and DNA fragmentation. In an in vitro assay, intact ETA induced ADP-ribosylation of EF-2 and ... (h) AEEAFDLWNECAKACVLDLKDGVRSSRMSVDPAIADTNGQGVLHYSMVLEGGNDALKLAIDN ALSITSDGLTIRLEGGVEPNKPVRYSYTRQARGSWSLNWLVPIGHEKPSNIKVFIHELNAGN QLSHMSPIYTIEMGDELLAKLARDATFFVRAHESNEMQPTLAISHAGVS...

Ngày tải lên: 18/02/2014, 04:20

... gate- ways to NF-kappaB activation and transcription. Onco- gene 25, 6685–6705. 26 DiDonato JA, Hayakawa M, Rothwarf DM, Zandi E & Karin M (1997) A cytokine-responsive IkappaB kinase that ... the oscillatory behavior of nuclear factor (NF-jB) is coupled to free IkappaB kinase-2 (IKK2) and IkappaBalpha(IjBa), and that the phosphorylation of IjBa by IKK influences the amp...

Ngày tải lên: 16/03/2014, 11:20

... lens spectrometry. Anal Chim Acta 250, 95–104. 3 Yi XF & Ben GY (2000) Seasonal variation in antioxi- dants of Polygonum viviparum and its relation to solar radiation in alpine meadow. Acta Bot Boreal Occident Sin ... with an argon ion laser. Acquired images were analyzed using image-pro plus 4.5 software. Materials o-Aminobenzenothiol was purchased from Fluka (Shang- hai, China)....

Ngày tải lên: 16/03/2014, 11:20

... separation and detection of native amino acids and the identification of electroactive and non-electroactive analytes. J. Chromatogr. A 2002, 1095, 193–196. 29. Xiaomi, X.; Weber, S.G. Carbon ... peak height was calculated using a chromatogram data integrator (Scientific Information Service Corp., Davis, CA, USA). The samples of L-cysteine and hydrogen tetrachloroa...

Ngày tải lên: 21/03/2014, 12:18