Báo cáo khoa học: Cloning and expression of a tomato cDNA encoding a methyl jasmonate cleaving esterase pdf

Báo cáo khoa học: Cloning and expression of the first nonmammalian interleukin-11 gene in rainbow trout Oncorhynchus mykiss pdf

Báo cáo khoa học: Cloning and expression of the first nonmammalian interleukin-11 gene in rainbow trout Oncorhynchus mykiss pdf

... the 5¢- and 3¢-UTR are underlined and the 13 repeats with a consensus of CCAATGATGATCCAAGAAATCCACACTACAG (31 bp) in the 3¢-UTR are numbered and distinguished from each other by alternate highlighting in ... insertion of 12 repeats with a consensus of CCAATGATGATCCAAGAAATCCACACTACAG (31 bp) in the 3¢-UTR of the cDNA sequence (Fig. 1). A TATA box was identified 28 bp upstre...

Ngày tải lên: 07/03/2014, 16:20

12 512 0
Báo cáo khoa học: Cloning and expression of a tomato cDNA encoding a methyl jasmonate cleaving esterase pdf

Báo cáo khoa học: Cloning and expression of a tomato cDNA encoding a methyl jasmonate cleaving esterase pdf

... Cloning and expression of a tomato cDNA encoding a methyl jasmonate cleaving esterase Christiane Stuhlfelder, Martin J. Mueller and Heribert Warzecha Lehrstuhl fu ¨ r Pharmazeutische ... Intra- cellular s eparation of MeJA synthesis and hydrolysis would be one way to avoid a treadmill situation, yet analysis of tomato MJE and Arabidopsis JMT reveals no...

Ngày tải lên: 16/03/2014, 18:20

8 458 1
Báo cáo khóa học: Cloning and expression of murine enzymes involved in the salvage pathway of GDP-L-fucose ppt

Báo cáo khóa học: Cloning and expression of murine enzymes involved in the salvage pathway of GDP-L-fucose ppt

... bp R5¢-GGCTTTGGCCATACGCATAC-3¢ 3081 P a 5¢-ACGGCCAGCGGCTCGCA-3¢ 3037 FK long F 5¢-GCAGGACGTGCTGAGGAACT-3¢ 2865 64 bp R5¢-CAGTCTGCGGGCATTCTGT-3¢ 2911 P a 5¢-CCACAACGGGCAACCGAGCG-3¢ 2889 PP F 5¢-AGCTGGGCTTACAATCCATAGCT-3¢ ... needed. Acknowledgements We thank Tuula Kallioinen and Sirkka-Liisa Kauranen for skilled technical assistance in molecular biology, and Kati Vena ¨ la ¨ inen and...

Ngày tải lên: 30/03/2014, 13:20

9 437 0
Tài liệu Báo cáo khoa học: Cloning and characterization of CBL-CIPK signalling components from a legume (Pisum sativum) ppt

Tài liệu Báo cáo khoa học: Cloning and characterization of CBL-CIPK signalling components from a legume (Pisum sativum) ppt

... C)AATTTC-3¢ PsCBL (degenerate forward) 45¢-GTATCAGCTTC(C ⁄ T)TCAAATGTC-3¢ PsCBL (degenerate reverse) 55¢-CCATCACAAGAAACTAGAGAAAC-3 PsCIPK (5¢UTR forward) 65¢-TTAAGTACTATAAAT-ACACAGCCTA-3¢ PsCIPK (3¢UTR ... T)GC(C ⁄ G ⁄ T)AAGGT-3¢ PsCIPK (degenerate forward) 25¢-ACAAA (A ⁄ C )A( A ⁄ G) (A ⁄ G ⁄ T )A( C ⁄ T) (A ⁄ C ⁄ G)ACACCACAAGACC)3¢ PsCIPK (degenerate reverse) 35¢-CTTAT(C ⁄ G)AACAAGGAA (A...

Ngày tải lên: 19/02/2014, 07:20

19 707 0
Tài liệu Báo cáo khóa học: Cloning and characterization of two distinct isoforms of rainbow trout heat shock factor 1 ppt

Tài liệu Báo cáo khóa học: Cloning and characterization of two distinct isoforms of rainbow trout heat shock factor 1 ppt

... Japan) and reared on a commercial diet at 15 °C. Cloning of HSF cDNA A random primed kZAPII cDNA library was constructed by using a kZapII predigested EcoRI/calf intestinal alkaline phosphatase-treated ... PCR was performed with the M13 forward primer (5¢-CCCAGTCACGACGTTGTAAAA CG-3¢)asasenseprimerandHSF1-specific primers (for HSF 1a, 5¢-GAAGCAGCTTGTCCAGTACACTAA-3¢;for HSF1b,5¢-...

Ngày tải lên: 19/02/2014, 12:20

10 539 0
Báo cáo khoa học: Cloning and characterization of the genes encoding toxic lectins in mistletoe (Viscum album L) pot

Báo cáo khoa học: Cloning and characterization of the genes encoding toxic lectins in mistletoe (Viscum album L) pot

... and XhoI ML3p A- chain 5¢- GATATA CATATG TACCGTCGTATTAGCCTTCGTGTCACGGAT -3¢ 5¢- CACAC GAATTC TTATTAAGAAGAAGAAGAACGGTCCCTGCATAC -3¢ NdeI and EcoRI ML3.1p A- chain 5¢- GATATA CATATG TACGAGCGTCTTCGTCTTCGTGTTACGCATC -3¢ 5¢- CACAC GAATTC TTATTAAGAAGAAGAAGAACGGTCCCTGCATAC -3¢ NdeI ... and XhoI ML2p A- chain 5¢- GATATA CATATG TACGAGCGTCTTCGTCTTCGTGTTACGCATC -3¢ 5¢- CACAC CTCGAG TTATTAAGAAGA...

Ngày tải lên: 07/03/2014, 15:20

11 611 0
Báo cáo Y học: Cloning and expression of sterol D14-reductase from bovine liver potx

Báo cáo Y học: Cloning and expression of sterol D14-reductase from bovine liver potx

... vector, and sequenced on both strands. The cloned cDNA was 1370 bp long and contained an ORF of 1257 bp, encoding a protein of 418 amino a cids with a calculated molecular mass of 46 751 Da. The ... Beccari 4 , Maria Agnese Della Fazia 4 and Giuseppe Servillo 4 1 Department of Internal Medicine, University of Perugia, Italy; 2 Department of Pharmacological Sciences...

Ngày tải lên: 08/03/2014, 16:20

8 494 0
Báo cáo Y học: Cloning and expression of two novel aldo-keto reductases from Digitalis purpurea leaves potx

Báo cáo Y học: Cloning and expression of two novel aldo-keto reductases from Digitalis purpurea leaves potx

... EMBL database and are available under accession numbers AJ309822 and AJ309823, respectively. DpAR1 and DpAR2 contain 948 bp long ORFs encoding 315 amino acids of a calculated molecular mass 34 ... (P23901); Avena, Avena fatua (S61421); Sesbania, Sesbania rostrata (CAA11226); Oryza, Oryza sativa (AAK52545); Medicago, M. sativa (X97606). AR proteins from mammals were used as the out...

Ngày tải lên: 18/03/2014, 01:20

9 570 0
Báo cáo khoa học: Cloning, over-expression, purification and characterization of Plasmodium falciparum enolase doc

Báo cáo khoa học: Cloning, over-expression, purification and characterization of Plasmodium falciparum enolase doc

... 2004 Cloning, over -expression, purification and characterization of Plasmodium falciparum enolase Ipsita Pal-Bhowmick, K. Sadagopan, Hardeep K. Vora, Alfica Sehgal*, Shobhona Sharma and Gotam K. Jarori Department ... falciparum NF54 LGANAILAISMAVCRAGAAANKVSLYKYLAQLAGKKSDQMVLPVPCLNVINGGSHAGNKL 171 P. falciparum K1 LGANAILAISMAVCRAGAAPNKVSLYKYLAQLAGKKSDQMVLPVPCLNVINGGSHAGNKL 171 P. yoel...

Ngày tải lên: 16/03/2014, 18:20

10 374 0
Báo cáo khoa học: Silencing the expression of mitochondrial acyl-CoA thioesterase I and acyl-CoA synthetase 4 inhibits hormone-induced steroidogenesis potx

Báo cáo khoa học: Silencing the expression of mitochondrial acyl-CoA thioesterase I and acyl-CoA synthetase 4 inhibits hormone-induced steroidogenesis potx

... for ACS4 and MTE-I in the hormonal regulation of steroidogenesis as a new pathway of arachidonic acid release different from the classical phospho- lipase A 2 cascade. Abbreviations AA, arachidonic ... thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoA to the nonesterified fatty acid and CoA [19] and that they can release AA from the arachidonoyl-...

Ngày tải lên: 16/03/2014, 18:20

11 302 0
w