0
  1. Trang chủ >
  2. Luận Văn - Báo Cáo >
  3. Báo cáo khoa học >

Báo cáo khoa học: Neuropeptide Y expression and function during osteoblast differentiation – insights from transthyretin knockout mice potx

Báo cáo khoa học: Neuropeptide Y expression and function during osteoblast differentiation – insights from transthyretin knockout mice potx

Báo cáo khoa học: Neuropeptide Y expression and function during osteoblast differentiation insights from transthyretin knockout mice potx

... Authors Journal compilation ª 2009 FEBS 275 Neuropeptide Y expression and function during osteoblast differentiation insights from transthyretin knockout mice Ana F. Nunes1,2,*, Ma´rcia A. Liz1, ... embryonic stages and in the adult, that NPY is synthesized byosteoblasts, osteocytes, and chondrocytes. Moreover, peptidylglycine a-am-idating monooxygenase, the enzyme responsible for NPY activation ... bonecells from WT and TTR KO mice. (A) NPYRT-PCR analysis in brain, MC3T3-E1 cells, and BMSCs. (B) NPY quantification inBMSCs from WT and TTR KO mice atdays 1, 3, 7 and 14 of differentiation intoosteoblasts....
  • 13
  • 413
  • 1
Báo cáo khoa học: Genomic structure, expression and characterization of a STAT5 homologue from pufferfish (Tetraodon fluviatilis) ppt

Báo cáo khoa học: Genomic structure, expression and characterization of a STAT5 homologue from pufferfish (Tetraodon fluviatilis) ppt

... domain, and C-terminal transactivation domain are encoded by exons 2–5 , 5–8 , and 1 7–1 9, respectively, while the SH2 domain isencoded by exons 1 5–1 6 and the DNA-binding domain byexons 9–1 2. These ... STAT1,STAT3, and STAT5, STATs 2, 4, and 6 have relativelyrestricted functions, centred on immune response regula-tion. STAT2 is activated only by a/b-interferon, STAT4 byIL-12andSTAT6byIL-4andIL-13[10,22,23].STAT5a ... master mixture and incubatedfor 90 min at 30 °C. The synthesized proteins are thenanalysed by SDS/PAGE and visualized by autoradio-graphy. For subsequent bandshift analysis and Westernblotting,...
  • 14
  • 456
  • 0
Tài liệu Báo cáo khoa học: Neuropeptide Y and osteoblast differentiation – the balance between the neuro-osteogenic network and local control ppt

Tài liệu Báo cáo khoa học: Neuropeptide Y and osteoblast differentiation the balance between the neuro-osteogenic network and local control ppt

... Sousa MM (2010) Neuropeptide Y expression and function during osteoblast differentiation insights from transthyretin knockout mice. FEBS J 277, 26 3–2 75.51 Baldock PA, Sainsbury A, Couzens M, ... 265 9–2 661.LeptinNPY Y2 Y1 Y2 NPYNPYOsteoblastsHypothalamusFat tissueSympathic nervous systemNPYCirculating NPYFig. 2. NPY regulatory network. NPY exerts its actions throughboth central and peripheral ... by NPY (highly expressed in the hypothalamus) and probablyalso by autocrine mechanisms, as osteoblasts (expressing Y1 and possibly Y2 ) are themselves capable of producing and secretingNPY.F....
  • 11
  • 783
  • 0
Tài liệu Báo cáo khoa học: Neuropeptide Y-family receptors Y6and Y7in chicken Cloning, pharmacological characterization, tissue distribution and conserved synteny with human chromosome region docx

Tài liệu Báo cáo khoa học: Neuropeptide Y-family receptors Y6and Y7in chicken Cloning, pharmacological characterization, tissue distribution and conserved synteny with human chromosome region docx

... NPY (cNPY)-familyreceptors, namely Y 1 ,Y 2 ,Y 4 and Y 5[2 7–2 9].The genes for Y 1 ,Y 2 and Y 5are clustered togetheron Homo sapiens chromosome 4 (Hsa4), the Y 4gene islocated on Hsa10 and ... ovary; cNPY, chicken neuropeptide Y; cPP, chicken pancreatic polypeptide; cPYY, chicken peptide YY; Hsa,Homo sapiens chromosome; pNPY, porcine neuropeptide Y; PP, pancreatic polypeptide; pPYY, ... appetite and circadian rhythm, by binding toG-protein coupled receptors. Mammals have five subtypes, named Y 1 ,Y 2, Y 4 ,Y 5 and Y 6, and recently Y 7has been discovered in fish and amphibi-ans....
  • 16
  • 580
  • 0
Báo cáo khoa học: Neuropeptide Y, B-type natriuretic peptide, substance P and peptide YY are novel substrates of fibroblast activation protein-a pdf

Báo cáo khoa học: Neuropeptide Y, B-type natriuretic peptide, substance P and peptide YY are novel substrates of fibroblast activation protein-a pdf

... megakaryocytes, adipose tissue and gut [45,46].Dipeptidyl peptidase truncation of NPY by FAP orDPP4 yields NPY 3–3 6. NPY 3–3 6is inactive on the Y1 receptor, and has greater affinity for the Y2 ... biologically relevant. As with NPY, removingthe N-terminal dipeptide from PYY alters its tertiarystructure, preventing it from stimulating its Y1 recep-tor, and thereby altering its function. PYY regulatesglucose ... Gorrell11 Centenary Institute, Sydney Medical School, University of Sydney, NSW, Australia2 Pharmaceutical Chemistry, Faculty of Pharmacy, University of Sydney, NSW, AustraliaKeywordsantiplasmin-cleaving...
  • 17
  • 425
  • 0
Báo cáo khoa học: Molecular cloning, expression and characterization of protein disulfide isomerase from Conus marmoreus pdf

Báo cáo khoa học: Molecular cloning, expression and characterization of protein disulfide isomerase from Conus marmoreus pdf

... cPDI and hPDI decreased the refolding yield of lysozyme(antichaperone activity). At high concentrations, bothcPDI and hPDI increased the refolding yield of lyso-zyme (chaperone activity). Thus, ... h, and then the lyso-zyme activity was measured. The refolding yields were calculated from the activity recovery on the basis of a standard curve.Fig. 3. The amino acid sequences of tx3a and ... previously [21], and its purity was ana-lyzed by SDS ⁄ PAGE.Enzymatic activity assays of PDIThe thiol-protein oxidoreductase activity of PDI was mea-sured as described previously, using insulin...
  • 10
  • 405
  • 0
Báo cáo khoa học: Molecular cloning, expression and characterization of cDNA encoding cis-prenyltransferases from Hevea brasiliensis A key factor participating in natural rubber biosynthesis pdf

Báo cáo khoa học: Molecular cloning, expression and characterization of cDNA encoding cis-prenyltransferases from Hevea brasiliensis A key factor participating in natural rubber biosynthesis pdf

... cis-pre-nyltransferase, a key enzyme in dolichol synthesis. Mol. Cell. Biol.19, 47 1–4 83.24. Oh, S.K., Han, K H., Ryu, S.B. & Kang, H. (2000) Molecularcloning, expression, and functional analysis ... Heptaprenylpyrophosphate synthetase from Bacillus subtilis. Meth Enzymol. 110,15 3–1 55.33. Fujikura, K., Zhang, Y W., Yoshizaki, H., Nishino, T. &Koyama, T. (2000) Significance of Asn-77 and ... University, Songkla, Thailand;3Department of Biochemistry, Mahidol University, Bangkok, Thailand;4Department ofBiochemistry, Prince of Songkla University, Hat-Yai, ThailandNatural rubber from...
  • 10
  • 516
  • 0
Báo cáo khoa học: Gene cloning, expression and characterization of avian cathelicidin orthologs, Cc-CATHs, fromCoturnix coturnix pdf

Báo cáo khoa học: Gene cloning, expression and characterization of avian cathelicidin orthologs, Cc-CATHs, fromCoturnix coturnix pdf

... GFS.QTPSYRDAVLRAVDDFNQQSLDT.NLYRLLDLDPEPQGD.EDPDTMETHKHGPSLAWWSLLLLLLGLLMPPAIA.QDLTYREAVLRAVDAFNQQSSEA.NLYRLLSMDPQQLED.AKPYTMETQKDSPSLGRWSLLLLLLGLVITPAAS.RALSYREAVLRAVNGFNQRSSEE.NLYRLLQLNSQPKGD.EDPNI MEGFFWKTLLVVGALAIAGTSSLPH.KPLIYEEAVDLAVSIYNSKSGEDS.LYRLLEAVSPPKWD.PLSESLLLLLLLLLLLLLLLLLLLLLLL Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAANNNNNNNNNNNNNNNNNNNNNNNRRRRRRRRRRRRRRRRRRRRRRRLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL ... activity.Antimicrobial activity of Cc-CATHsCc-CATH2 and Cc-CATH3 were commercially synthe-sized by the standard solid phase synthesis method and purified to > 95% purity. LL-37 characterized from ... displayed negligible hemolytic activities, lysing only3.6% and 4.1% of erythrocytes at concentrations up to26.9 lm (100 lgÆmL)1) and 29.6 lm (100 lgÆmL)1),respectively. The hemolysis concentrations...
  • 12
  • 406
  • 0
Báo cáo khoa học: Structure, mRNA expression and linkage mapping of the brain-type fatty acid-binding protein gene (fabp7 ) from zebrafish (Danio rerio) potx

Báo cáo khoa học: Structure, mRNA expression and linkage mapping of the brain-type fatty acid-binding protein gene (fabp7 ) from zebrafish (Danio rerio) potx

... (nucleotides 1–1 43, 29 0–4 62, 61 6–7 17 and 208 1–2 370,respectively) separated by three introns (nucleotides 14 4– 289, 46 3–6 15 and 71 8–2 080, respectively), is the same as forall the FABP genes and other ... lambdaDNA and gel-purified B-FABP and b-actin RT-PCRproducts were allowed to bind SYBRÒ Green dye and the amount of bound SYBRÒ Green I was determined byfluorimetry. The concentration of B-FABP and ... cATGCcaattV$ECAT/NFY.02 nuclear factor Y )147 (–) 1.000 0.925 aatCCAAtaacV$ECAT/NFY.02 nuclear factor Y )1091 (–) 1.000 0.906 ccaCCAAtatcV$ECAT/NFY.02 nuclear factor Y )1122 (–) 1.000 0.915 tcaCCAAttgaV$ECAT/NFY.01...
  • 11
  • 366
  • 0
Báo cáo khoa học: NMR solution structure and function of the C-terminal domain of eukaryotic class 1 polypeptide chain release factor pdf

Báo cáo khoa học: NMR solution structure and function of the C-terminal domain of eukaryotic class 1 polypeptide chain release factor pdf

... found that eRF1 and eRF3 form ternary and quaternary complexes in solution with GTP and Mg2+(eRF1–eRF3–GTP and eRF1–eRF3–GTP–Mg2+) [17]. Yeast two-hybrid and deletion analyseshave revealed ... secondary structural ele-ments: b-strands (b3, 32 9–3 35; b4, 33 9–3 44; and b5,36 7–3 72) and a distorted a-helix (a3, 34 8–3 56)(Fig. 3B,C). The three b-strands of the minidomain areall antiparallel, and ... were processed by nmrpipe, and ana-lyzed using sparky (from Goddard and Kneller; http://www.cgl.ucsf.edu/home/sparky) and autoassign [40].Sequential backbone assignments [41] and side chainsassignments...
  • 17
  • 490
  • 0

Xem thêm

Từ khóa: báo cáo khoa học y dượcbáo cáo khoa họcbáo cáo khoa học mẫubáo cáo khoa học sinh họcbáo cáo khoa học nông nghiệpbáo cáo khoa học lâm nghiệpBáo cáo thực tập tại nhà thuốc tại Thành phố Hồ Chí Minh năm 2018Một số giải pháp nâng cao chất lượng streaming thích ứng video trên nền giao thức HTTPBiện pháp quản lý hoạt động dạy hát xoan trong trường trung học cơ sở huyện lâm thao, phú thọGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANQuản lý hoạt động học tập của học sinh theo hướng phát triển kỹ năng học tập hợp tác tại các trường phổ thông dân tộc bán trú huyện ba chẽ, tỉnh quảng ninhPhối hợp giữa phòng văn hóa và thông tin với phòng giáo dục và đào tạo trong việc tuyên truyền, giáo dục, vận động xây dựng nông thôn mới huyện thanh thủy, tỉnh phú thọNghiên cứu, xây dựng phần mềm smartscan và ứng dụng trong bảo vệ mạng máy tính chuyên dùngNghiên cứu về mô hình thống kê học sâu và ứng dụng trong nhận dạng chữ viết tay hạn chếTổ chức và hoạt động của Phòng Tư pháp từ thực tiễn tỉnh Phú Thọ (Luận văn thạc sĩ)Quản lý nợ xấu tại Agribank chi nhánh huyện Phù Yên, tỉnh Sơn La (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtGiáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtchuong 1 tong quan quan tri rui roGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtTrách nhiệm của người sử dụng lao động đối với lao động nữ theo pháp luật lao động Việt Nam từ thực tiễn các khu công nghiệp tại thành phố Hồ Chí Minh (Luận văn thạc sĩ)