Báo cáo khoa học: Neuropeptide Y expression and function during osteoblast differentiation – insights from transthyretin knockout mice potx

Báo cáo khoa học: Neuropeptide Y expression and function during osteoblast differentiation – insights from transthyretin knockout mice potx

Báo cáo khoa học: Neuropeptide Y expression and function during osteoblast differentiation – insights from transthyretin knockout mice potx

... Authors Journal compilation ª 2009 FEBS 275 Neuropeptide Y expression and function during osteoblast differentiation – insights from transthyretin knockout mice Ana F. Nunes 1,2, *, Ma ´ rcia A. Liz 1 , ... embryonic stages and in the adult, that NPY is synthesized by osteoblasts, osteocytes, and chondrocytes. Moreover, peptidylglycine a-am- idating monooxyge...

Ngày tải lên: 15/03/2014, 09:20

13 413 1
Báo cáo khoa học: Genomic structure, expression and characterization of a STAT5 homologue from pufferfish (Tetraodon fluviatilis) ppt

Báo cáo khoa học: Genomic structure, expression and characterization of a STAT5 homologue from pufferfish (Tetraodon fluviatilis) ppt

... domain, and C-terminal transactivation domain are encoded by exons 2–5 , 5–8 , and 1 7–1 9, respectively, while the SH2 domain is encoded by exons 1 5–1 6 and the DNA-binding domain by exons 9–1 2. These ... STAT1, STAT3, and STAT5, STATs 2, 4, and 6 have relatively restricted functions, centred on immune response regula- tion. STAT2 is activated only by a/b-interferon, S...

Ngày tải lên: 31/03/2014, 07:20

14 456 0
Tài liệu Báo cáo khoa học: Neuropeptide Y and osteoblast differentiation – the balance between the neuro-osteogenic network and local control ppt

Tài liệu Báo cáo khoa học: Neuropeptide Y and osteoblast differentiation – the balance between the neuro-osteogenic network and local control ppt

... Sousa MM (2010) Neuropeptide Y expression and function during osteoblast differentiation – insights from transthyretin knockout mice. FEBS J 277, 26 3–2 75. 51 Baldock PA, Sainsbury A, Couzens M, ... 265 9–2 661. Leptin NPY Y2 Y1 Y2 NPY NPY Osteoblasts HypothalamusFat tissue Sympathic nervous system NPY Circulating NPY Fig. 2. NPY regulatory network. NPY...

Ngày tải lên: 18/02/2014, 04:20

11 784 0
Tài liệu Báo cáo khoa học: Neuropeptide Y-family receptors Y6and Y7in chicken Cloning, pharmacological characterization, tissue distribution and conserved synteny with human chromosome region docx

Tài liệu Báo cáo khoa học: Neuropeptide Y-family receptors Y6and Y7in chicken Cloning, pharmacological characterization, tissue distribution and conserved synteny with human chromosome region docx

... NPY (cNPY)-family receptors, namely Y 1 ,Y 2 ,Y 4 and Y 5 [2 7–2 9]. The genes for Y 1 ,Y 2 and Y 5 are clustered together on Homo sapiens chromosome 4 (Hsa4), the Y 4 gene is located on Hsa10 and ... ovary; cNPY, chicken neuropeptide Y; cPP, chicken pancreatic polypeptide; cPYY, chicken peptide YY; Hsa, Homo sapiens chromosome; pNPY, porcine neuropeptide Y; PP,...

Ngày tải lên: 19/02/2014, 07:20

16 581 0
Báo cáo khoa học: Neuropeptide Y, B-type natriuretic peptide, substance P and peptide YY are novel substrates of fibroblast activation protein-a pdf

Báo cáo khoa học: Neuropeptide Y, B-type natriuretic peptide, substance P and peptide YY are novel substrates of fibroblast activation protein-a pdf

... megakaryocytes, adipose tissue and gut [45,46]. Dipeptidyl peptidase truncation of NPY by FAP or DPP4 yields NPY 3–3 6 . NPY 3–3 6 is inactive on the Y1 receptor, and has greater affinity for the Y2 ... biologically relevant. As with NPY, removing the N-terminal dipeptide from PYY alters its tertiary structure, preventing it from stimulating its Y1 recep- tor, and thereby a...

Ngày tải lên: 14/03/2014, 23:20

17 425 0
Báo cáo khoa học: Molecular cloning, expression and characterization of protein disulfide isomerase from Conus marmoreus pdf

Báo cáo khoa học: Molecular cloning, expression and characterization of protein disulfide isomerase from Conus marmoreus pdf

... cPDI and hPDI decreased the refolding yield of lysozyme (antichaperone activity). At high concentrations, both cPDI and hPDI increased the refolding yield of lyso- zyme (chaperone activity). Thus, ... h, and then the lyso- zyme activity was measured. The refolding yields were calculated from the activity recovery on the basis of a standard curve. Fig. 3. The amino acid sequences of tx...

Ngày tải lên: 07/03/2014, 05:20

10 406 0
Báo cáo khoa học: Molecular cloning, expression and characterization of cDNA encoding cis-prenyltransferases from Hevea brasiliensis A key factor participating in natural rubber biosynthesis pdf

Báo cáo khoa học: Molecular cloning, expression and characterization of cDNA encoding cis-prenyltransferases from Hevea brasiliensis A key factor participating in natural rubber biosynthesis pdf

... cis-pre- nyltransferase, a key enzyme in dolichol synthesis. Mol. Cell. Biol. 19, 47 1–4 83. 24. Oh, S.K., Han, K H., Ryu, S.B. & Kang, H. (2000) Molecular cloning, expression, and functional analysis ... Heptaprenylpyrophos phate synthetase from Bacillus subtilis. Meth Enzymol. 110, 15 3–1 55. 33. Fujikura, K., Zhang, Y W., Yoshizaki, H., Nishino, T. & Koyama, T. (2000) Si...

Ngày tải lên: 07/03/2014, 21:20

10 517 0
Báo cáo khoa học: Gene cloning, expression and characterization of avian cathelicidin orthologs, Cc-CATHs, fromCoturnix coturnix pdf

Báo cáo khoa học: Gene cloning, expression and characterization of avian cathelicidin orthologs, Cc-CATHs, fromCoturnix coturnix pdf

... GFS.QTPSYRDAVLRAVDDFNQQSLDT.NLYRLLDLDPEPQGD.EDPDT METHKHGPSLAWWSLLLLLLGLLMPPAIA.QDLTYREAVLRAVDAFNQQSSEA.NLYRLLSMDPQQLED.AKPYT METQKDSPSLGRWSLLLLLLGLVITPAAS.RALSYREAVLRAVNGFNQRSSEE.NLYRLLQLNSQPKGD.EDPNI MEGFFWKTLLVVGALAIAGTSSLPH.KPLIYEEAVDLAVSIYNSKSGEDS.LYRLLEAVSPPKWD.PLSES L L L L L L L L L L L L L L L L L L L L L L L Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y Y A A...

Ngày tải lên: 28/03/2014, 23:20

12 407 0
Báo cáo khoa học: Structure, mRNA expression and linkage mapping of the brain-type fatty acid-binding protein gene (fabp7 ) from zebrafish (Danio rerio) potx

Báo cáo khoa học: Structure, mRNA expression and linkage mapping of the brain-type fatty acid-binding protein gene (fabp7 ) from zebrafish (Danio rerio) potx

... (nucleotides 1–1 43, 29 0–4 62, 61 6–7 17 and 208 1–2 370, respectively) separated by three introns (nucleotides 14 4– 289, 46 3–6 15 and 71 8–2 080, respectively), is the same as for all the FABP genes and other ... lambda DNA and gel-purified B-FABP and b-actin RT-PCR products were allowed to bind SYBRÒ Green dye and the amount of bound SYBRÒ Green I was determined...

Ngày tải lên: 31/03/2014, 07:20

11 367 0
Báo cáo khoa học: NMR solution structure and function of the C-terminal domain of eukaryotic class 1 polypeptide chain release factor pdf

Báo cáo khoa học: NMR solution structure and function of the C-terminal domain of eukaryotic class 1 polypeptide chain release factor pdf

... found that eRF1 and eRF3 form ternary and quaternary complexes in solution with GTP and Mg 2+ (eRF1–eRF3–GTP and eRF1–eRF3–GTP– Mg 2+ ) [17]. Yeast two-hybrid and deletion analyses have revealed ... secondary structural ele- ments: b-strands (b3, 32 9–3 35; b4, 33 9–3 44; and b5, 36 7–3 72) and a distorted a-helix (a3, 34 8–3 56) (Fig. 3B,C). The three b-strands of the m...

Ngày tải lên: 06/03/2014, 11:20

17 491 0
w