Tài liệu Báo cáo khoa học: "EXPERIMENTS AND PROSPECTS OF EXAMPLE-BASED MACHINE TRANSLATION" ppt
Tài liệu Báo cáo khoa học: "EXPERIMENTS AND PROSPECTS OF EXAMPLE-BASED MACHINE TRANSLATION" ppt
... EXPERIMENTS AND PROSPECTS OF EXAMPLE-BASED MACHINE TRANSLATION Eiichiro SUMITA* and Hitoshi HDA ATR Interpreting Telephony Research Laboratories ... in machine translation, a database of examples (pairs of source phrases, sentences, or texts and * Currently with Kyoto University Figure 1 shows the basic flow of EBMT using translation of ... consists of two databases: an example database and a thesaurus; and also three translation modules: analysis, example-based transfer, and generation (Figure 3). Examples (pairs of source...
- 8
- 501
- 0
Tài liệu Báo cáo khoa học: Structure and function of plant aspartic proteinases pptx
... isoforms by the excision of the prosegment and of most of the PSI [21]. Conversely to what has been foundin vivo [31], heavy and light chains of the processed forms of recombinant cyprosin are ... by the prosegment, but also bythe 13 residues of the N-terminal of the mature enzyme and by the ÔflapÕ. The anchorage of the prosegment and of part of the N-terminus in the active site cleft is ... prosegment and total or partial removal of the internalFig. 1. Plant aspartic proteinase precursors. Comparison of the aminoacid sequences of representative members of the A1 family of plantaspartic...
- 9
- 605
- 0
Tài liệu Báo cáo khoa học: "Analysis and Repair of Name Tagger Errors" pptx
... errors of each type. Errors of identifica-tion will be further subdivided by type (missing names, spurious names, and boundary errors). We believe such detailed understanding of the benefits of ... value of N required to include the best hypothesis, as a function of the margin. We then divide the margin into ranges of values, and set a value of N for each range, with a maximum of 30. ... nominalization representing the event) and a set of arguments. When a name candidate is in-volved in an event, the trigger word and other arguments of the event can help to determine the name...
- 8
- 399
- 0
Tài liệu Báo cáo khoa học: "Bilingual Sense Similarity for Statistical Machine Translation" ppt
... ==⋅⋅==IifaIIfIiJjejifafafafiijiwsqrtwsqrtwefwvvvvvvsimvvvvvvγα (12) where I and J are the number of the words in source and target bag -of- words; ifw and jew are values of source and target features; ifaw is the transformed ... the size of the vector to 500 for Alg1; while for Alg2, we set the sizes of fullfC and fulleCN1 to 1000, and the sizes of coocfC and cooceCN2 to 100. The sizes of the vectors ... collected from the training data, and two “bags -of- words” which consist of col-lections of source and target context words co-occurring with the rule’s source and target sides are created. },...
- 10
- 594
- 0
Tài liệu Báo cáo khoa học: Structure and function of active chromatin and DNase I hypersensitive sites pdf
... withbinding of both MOF and Tip60 (equivalent to Esa1in yeast NuA4) [124,130]. However, in human cellsdepletion of MOF, but not Tip60, results in reducedglobal levels of AcH4-K16 and defective ... acetylation and deacetyla-tion, and transient recruitment of remodellers and transcription factors.A cycle of transcription commences with the recruit-ment of transcription factors and co-factors ... implications of the cycle of histone acetylation and deacetylationthat accompanies cycles of transcription, and highlightthe special significance of histone H4 lysine 16 acety-lation.Basic features of...
- 29
- 743
- 0
Tài liệu Báo cáo khoa học: miRNAs and regulation of cell signaling pptx
... Scientific Fund of the Ministry of Education,Science and Culture of Japan (G.T.); the Program forPromotion of Fundamental Studies in Health Sciences of the National Institute of Biomedical InnovationTable ... tumors and cell lines, miR-17-5p and miR-20a are induced in a manner that dependson cyclin D1 and repress the expression of cyclin D1.Hence, miR-17-5p ⁄ 20a and cyclin D1 form a feedbackloop and ... of E2F and Myc [52]. In tumor progression, the tran-scription repressors ZEB1 and SIP1 and the miR-200family of miRNAs provide a double-negative-feedbackloop that regulates the phenotype of...
- 9
- 684
- 0
Tài liệu Báo cáo khoa học: Expression and secretion of interleukin-1b, tumour necrosis factor-a and interleukin-10 by hypoxia- and serum-deprivation-stimulated mesenchymal stem cells Implications for their paracrine roles ppt
... in order to secrete IL-1b and TNF-a.Hypoxia⁄SD induces the transcription and secretion of IL-10Because of the lack of secretion of the inflammatorycytokines IL-1b and TNF-a from hypoxia ⁄ ... presence and absence of IL-10. *P < 0.05 and **P < 0.01 versus Cont group. (D) Representativewestern blots for collagen I and III in the presence and absence of 0.1 lM angiotensin II and IL-10.Paracrine ... conditions.Taken together, these findings may improve understanding of the cellu-lar and molecular basis of the anti-inflammatory and paracrine effects of mesenchymal cells.AbbreviationsBrdU, 5-bromodeoxyuridine;...
- 11
- 653
- 0
Tài liệu Báo cáo khoa học: Investigation and prediction of the severity of p53 mutants using parameters from structural calculations pptx
... advantage of p53 mutation analysis, and a unique feature of this database, is the availabil-ity of the residual activity of the majority of p53 mis-sense mutants. The biological activity of mutant ... coredomain of the protein and were used for training and evalua-tion of our prediction algorithm. Of the eight promoters, westudied the WAF1 promoter in greatest detail with additionaltesting and ... so. This is indicated by the averageactivity of mutants in the central domain of 26% forWAF1 and 34% for MDM2, 71% for NOXA and 61%for p53R2, and around 45% for the other four promot-ers....
- 14
- 561
- 0
Tài liệu Báo cáo khoa học: Isolation and characterization of four type 2 ribosome inactivating pulchellin isoforms from Abrus pulchellus seeds docx
... Mrvalues of the standards in thousands. Lanes 2–9, 5 lg of peakP I, P II, P III ⁄ P IV and a mixture of other isoforms (*), respec-tively, in the presence (lanes 2–5) or absence (lanes 6–9) of 2-mercaptoethanol. ... similarity of the A- and B-chains of the four isoforms, a pairwise alignmentwas performed and the values of identity expressed inFig. 3. (Continued).Characterization of four pulchellin isoforms ... III and P IV isoforms from the eluate P III ⁄ P IV (Fig. 1C).Isoelectric focusing gave pI of 5.8, 5.7, 5.5 and 5.2 forthe four isoforms respectively.Secondary structure of the pulchellin isoformsand...
- 12
- 763
- 0
Tài liệu Báo cáo khoa học: Expression and function of Noxo1c, an alternative splicing form of the NADPH oxidase organizer 1 doc
... FunctionalAnalyses from the Ministry of Education, Culture,Sports, Science and Technology of Japan, and CREST and BIRD projects of JST (Japan Science and Technology Agency).References1 Segal ... extent of membranelocalization of Noxo1b and Noxo1c. Theintensities of immunoreactive bands forHA-Noxo1b and HA-Noxo1c in (B) werequantified using a LAS-1000plus (Fuji film)image analyzer and ... SH3 domain of Noxo1 participates inregulation of Nox3, the role of the PX domain in Nox3activity remains unknown.In the process of cloning of human Noxo1, somespliced transcripts of the NOXO1...
- 15
- 632
- 0
Từ khóa: tài liệu báo cáo nghiên cứu khoa họctài liệu về báo cáo khoa họcbáo cáo khoa học tài chính côngbáo cáo khoa học số loài quý hiếm tại vườn quốc gia ba bểtai lieu bao cao thuc tap khoa co khitai lieu bao cao thuc tap tai khoa duoc benh vienNghiên cứu sự hình thành lớp bảo vệ và khả năng chống ăn mòn của thép bền thời tiết trong điều kiện khí hậu nhiệt đới việt namNghiên cứu tổ chức pha chế, đánh giá chất lượng thuốc tiêm truyền trong điều kiện dã ngoạiMột số giải pháp nâng cao chất lượng streaming thích ứng video trên nền giao thức HTTPBiện pháp quản lý hoạt động dạy hát xoan trong trường trung học cơ sở huyện lâm thao, phú thọGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANNGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN SLIDEPhát triển du lịch bền vững trên cơ sở bảo vệ môi trường tự nhiên vịnh hạ longPhát hiện xâm nhập dựa trên thuật toán k meansThơ nôm tứ tuyệt trào phúng hồ xuân hươngThiết kế và chế tạo mô hình biến tần (inverter) cho máy điều hòa không khíTổ chức và hoạt động của Phòng Tư pháp từ thực tiễn tỉnh Phú Thọ (Luận văn thạc sĩ)Tăng trưởng tín dụng hộ sản xuất nông nghiệp tại Ngân hàng Nông nghiệp và Phát triển nông thôn Việt Nam chi nhánh tỉnh Bắc Giang (Luận văn thạc sĩ)chuong 1 tong quan quan tri rui roNguyên tắc phân hóa trách nhiệm hình sự đối với người dưới 18 tuổi phạm tội trong pháp luật hình sự Việt Nam (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtHIỆU QUẢ CỦA MÔ HÌNH XỬ LÝ BÙN HOẠT TÍNH BẰNG KIỀM