Tài liệu Báo cáo khoa học: "Man* vs Machine: A Case Study in Base Noun Phrase Learning" pdf

... Man* vs. Machine: A Case Study in Base Noun Phrase Learning Eric Brill and Grace Ngai Department of Computer Science The Johns Hopkins University Baltimore, MD 21218, USA Email: (brill,gyn}~cs. ... heuristics along with a grammar; Voutilainen's NPTool (1993) uses a lexicon combined with a constraint grammar; Juteson and Katz (1995) use repeated phrases; Ve...

Ngày tải lên: 20/02/2014, 19:20

... Tsubaki T, Takegawa S, Hanamoto H, Arita N, Kamogawa J, Yamamoto H, Takubo N, Nakata S, Yamada K, Yamamoto S et al. (2005) Accumulation of plasma cells expressing CXCR3 in the synovial sublin- ing ... Immunolocalization analysis indicated that IP-10 ⁄ CXCL10 is associated mainly with in ltrating macrophage-like cells and fibroblast-like cells in the RA synovium, and the inter- action of a...

Ngày tải lên: 18/02/2014, 18:20

... to allow for the inclusion. Let T denote the original training data, and T  denote the additional train- ing data. For the all -in- one model, the additional training data cannot be incorp orated ... orig- inal ACE training data with it. It is important to note here that the ACE training data (called T in Section 3.4) is consistent with the additional training data T  : the annotation gui...

Ngày tải lên: 08/03/2014, 02:21

... natural language system. This appears to be viable alternative [7] if proper precautions are taken. Paper and pencil studies are a suprisingly useful approach and are valuable since administration ... provide assis- tance by representing and displaying data in a useful format, providing guidance in choosing alternative strategies, offering effective messages at each stage 10)...

Ngày tải lên: 21/02/2014, 20:20

... concept in antimalarial research. Introduction As long as effective vaccines against malaria remain unavailable, the search for new antimalarial drugs is still required because of the incomplete ... protease catalytic class, was previously reported [12]. Accordingly, an additional inhibition assay was performed using P. falciparum protein extracts and including cathepsin D (an aspartic prot...

Ngày tải lên: 14/02/2014, 14:20

... DHSs observed in mammalian cytokine genes [91]. NFAT, in turn, plays a major role in assisting the binding of AP-1 via cooperative binding, and creates an accessi- ble environment that also enables Sp1 and ... If a similar mechanism operates in mammalian cells, then KDM 2A may suppress this pathway and maintain histone acetylation at tran- scribed CG islands. It is becoming incre...

Ngày tải lên: 14/02/2014, 18:20

... RRDYHSVRRPDVLLHSAHHG Gamma QQAWPGRQSQEGAGLPSHHGRPAGLLPHLSG-LEAGAVSARRDAY RRSDLLLPHAHAL Epsilon QAAWAAPRAAARAHEE PPGLLAPPARALG-LDP RRDYA TAVPRLLHGLADG Delta IHHGEPTDFINLHNARALKSSCLDEQRRELGCLDAYR RHDLS ... was shown that the broad-complex, tramtrack and bric -a- brac domain containing protein KCTD1 directly binds to AP- 2a and acts as a negative regulator for AP- 2a trans- activation [34...

Ngày tải lên: 16/02/2014, 09:20

... identified as an interaction partner for ADAM10 that enhances a- sec- retase shedding of APP, probably by regulating matu- ration of the prodomain of ADAM10 [22]. The catalytical domain of ADAM10 contains ... consists of a prodo- main, a catalytical domain with a conserved zinc bind- ing sequence, a cysteine-rich disintegrin-like domain, a transmembrane domain and a rather short c...

Ngày tải lên: 16/02/2014, 09:20

... catalytic activity of the isolated MLL1 SET domain. However, an analysis of crystal packing forces suggests that the SET-I lobe may be constrained in an unnatural conformation in the crys- talline ... such additional mechanism that could also be involved in targeting MLL1 to specific loci. TAD The CBP protein and its homolog p300 are general transcriptional co-activators that contain his...

Ngày tải lên: 16/02/2014, 14:20

... Escherichia coli DsbA and DsbC, as well as the isolated catalytic a domain of PDI. Both the PDI a domain and DsbA have a catalytic site, with an associated substrate-binding site, but lack an inde- pendent ... that bacitracin is not a selective inhibi- tor of PDI. Instead, bacitracin can also interact with folding polypeptide chains and other molecular chaper- ones and folding catalys...

Ngày tải lên: 16/02/2014, 14:20