what skills are needed to be a brain surgeon

Food and Beverage Marketing to Children and Adolescents: What Changes are Needed to Promote Healthy Eating Habits? ppt

Food and Beverage Marketing to Children and Adolescents: What Changes are Needed to Promote Healthy Eating Habits? ppt

... programming on Spanish-language stations and stations that predominantly target African- American audiences are also exposed to a large number of commercials for food and beverages. A content analysis ... diet and diet-related health? What strategies should be used as part of social ■ marketing programs to promote healthy diets? What factors shape the health and nutrition attitudes and behaviors ... healthy dietary behaviors (e.g., lead efforts to increase the availability of healthy food and beverage options in stores and restaurants). Companies that market food, beverages and restaurants ■ should...

Ngày tải lên: 07/03/2014, 10:20

12 551 0
''''The Worst Place in the World to be a Woman or Girl'''' – Rape in the DR Congo: Canada, Where Are You? docx

''''The Worst Place in the World to be a Woman or Girl'''' – Rape in the DR Congo: Canada, Where Are You? docx

... Bolivia, Caribbean, Colombia, Ethiopia, Ghana, Haiti, Honduras, Indonesia, Mali, Mozambique, Pakistan, Peru, Senegal, Sudan, Tanzania, Ukraine, Vietnam, West Bank/Gaza are designated to receive ... of Canada’s bilateral assistance, see, CIDA, “Canada Moves on Another Element of its Aid Effectiveness Agenda,” 23 February 2009, available at http://www.acdi- cida.gc.ca/CIDAWEB/acdicida.nsf/En/NAT-223132931-PPH, ... Council—African Union Peace and Security Council.” 67 CIDA, “Canada and the G8 Africa Action Plan: Maintaining the Momentum,” 12; finally Canada financially supported the Goma Peace Process that took...

Ngày tải lên: 22/03/2014, 21:20

27 416 0
who wants to be a millionaire ?

who wants to be a millionaire ?

... 3.000 5. 2.500 4. 2.000 3. 1.500 2. 1.000 1. 500 50:50 6. One , two and three are _____ . A. numbers D. streets C. names B. number SORRY . YOU NOT RIGHT 50:50 15. 20.000 14 18.000 13. 16.000 12. ... 6.000 8. 5.000 7. 4.000 6. 3.000 5. 2.500 4. 2.000 3. 1.500 2. 1.000 1. 500 50:50 3 .What is your name? __ name is Lan . A. mine D. her C. my B. your SORRY . YOU NOT RIGHT 50:50 15. 20.000 14 ... 4.000 6. 3.000 5. 2.500 4. 2.000 3. 1.500 2. 1.000 1. 500 50:50 12. Bao is playing ___ A. yo – yo D. to a yo - yo C. with a yo - yo B. with yo - yo 50:50 15. 20.000 14 18.000 13. 16.000 12....

Ngày tải lên: 29/06/2013, 01:27

47 398 3
HOW TO BE A GOOD LEADER

HOW TO BE A GOOD LEADER

... expect him to do? Cats do what cats do, ducks do what ducks do, and eagles do what eagles do. If you take a duck and ask it to do an eagle’s job, shame on you.As a leader, your job is to help ... I have a terrible attitude a 1 on a scale of 1 to 10—I can improve it all the way up to a 10 by making the right choices. I can choose to have a great attitude. In contrast, natural ability ... trying to turn ducks into eagles. All I did was frustrate them and myself. You shouldn’t ask someone to grow in areas where they have no natural talent. Why? Because our ability to grow and change...

Ngày tải lên: 24/10/2013, 02:15

11 720 1
Tài liệu How to be a Programmer: A Short, Comprehensive, and Personal Summary ppt

Tài liệu How to be a Programmer: A Short, Comprehensive, and Personal Summary ppt

... possible. lingua franca A language so popular as to be a de facto standard for its field, as French was for international diplomacy at one time. logging The practice of writing a program so that it can produce ... useful. strawman A document meant to be the starting point of a technical dis- cussion. A strawman may lead to a stickman, tinman, wood- man, ironman, etc. tribe A group of people you share cultural affinity ... your teammates do this. Working for a week on a program to do a task that will take a week to do by hand has the great ad- vantage of being more educational and sometimes more repeatable. If all...

Ngày tải lên: 21/12/2013, 20:15

58 487 0
Tài liệu How to be a Programmer: A Short, Comprehensive, and Personal Summary pptx

Tài liệu How to be a Programmer: A Short, Comprehensive, and Personal Summary pptx

... are particularly applicable to lousy code. You may not be able to redesign a large block of code, but if you can add a certain amount of abstraction to it you can obtain some of the benefits ... the task for you or to help your teammates do this. Working for a week on a program to do a task that will take a week to do by hand has the great ad- vantage of being more educational and sometimes ... one-dimensional. Even if a core language is mandated and beyond your control, it is often the case that tools and other programs can and should be written in a dif- ferent language. If a language is to be...

Ngày tải lên: 18/01/2014, 06:20

58 461 0
Tài liệu How To Be A Transformational Leader ppt

Tài liệu How To Be A Transformational Leader ppt

... a way that their behaviors can become better theo định hướng chuyển biến hành vi c a họ tốt hơn ,because their beliefs are more accurate, bởi vì niềm tin c a họ sẽ được củng cố, are deeper, are ... ta cần có, perhaps the most important one, is called relational capital. cũng có lẽ là loại giữ vai trò quan trọng nhất, nguồn lực vốn quan hệ. A transformational leader has relational capital. ... thứ ba mà transformational leaders always have. bất kỳ vị lãnh đạo thuyết phục thay đổi nào cũng có, It's called reputational capital. Nó được gọi là vốn uy tín. I mean I'll bet that...

Ngày tải lên: 24/01/2014, 07:20

21 638 2
Tài liệu Golf in the Year 2000, or, What we are coming to pdf

Tài liệu Golf in the Year 2000, or, What we are coming to pdf

... are scarce—at least I suppose they are now, they used to be a hundred years ago. The green at Golfton was completely altered. We began to play at what was in my day the eighth hole. A plantation ... now, behold —here I was “in a box” and no mis- take, for I found myself to be lying in what I took to be a sort of coffin. I began to wonder if this was not a dream, and tried to recall what I had been ... it’s time to laugh or not, I don’t know.” My next discovery—rather a startling one for a man that had gone to bed a few hours before cleanshaven—was that I had a beard. And such a beard! Why,...

Ngày tải lên: 17/02/2014, 15:20

62 483 0
Tài liệu Transfer of Skills from Spanish to English: A Study of Young Learners doc

Tài liệu Transfer of Skills from Spanish to English: A Study of Young Learners doc

... that basic interpersonal communication skills acquired in one language do not appear to transfer to a second language, whereas skills that are academically mediated (transfer of learned academic ... of data, we will examine the data with a different analytical approach—structural equation modeling. The advantage of this approach is that it will enable us to define our variables—for example, ... here are preliminary because they are based only on the first 3 years of a planned 4 years of data collection. Our preliminary analysis indicates that an effect of transfer from Spanish to English...

Ngày tải lên: 24/02/2014, 18:20

29 647 0
Báo cáo khoa học: Saccharomyces cerevisiae coq10 null mutants are responsive to antimycin A ppt

Báo cáo khoa học: Saccharomyces cerevisiae coq10 null mutants are responsive to antimycin A ppt

... Renata Ogusucu 2 , Ohara Augusto 2 , Jose Ribamar Ferreira-Junior 3 , Alexander Tzagoloff 4 , Alicia J. Kowaltowski 2 and Mario H. Barros 1 1 Departamento de Microbiologia, Instituto de Ciencias ... in rich media containing galactose as a carbon source [40]. Western blot quantifications were performed with 1dscan ex software (Scanalytics, Fairfax, VA, USA) For BN-PAGE, mitochondrial proteins ... Biomedicas, Universidade de Sao Paulo, Brazil 2 Departmento de Bioquimica, Instituto de Quimica, Universidade de Sao Paulo, Brazil 3 Escola de Artes, Cie ˆ ncias e Humanidades, Universidade de Sao Paulo,...

Ngày tải lên: 06/03/2014, 22:21

9 338 0
How to be a Million dollar producer pptx

How to be a Million dollar producer pptx

... United States. If you want to be a million-dollar producer, get trained in sales. I was an accounting major and graduated to become a CPA. Another way to say this is I had no people skills. Although ... to become an expert speaker. I called the National Speakers Association and asked them to recommend their best coach. I called the coach and was told she charged $7,500 for two-and -a- half days ... reasons you normally seek to save money are because you believe it is scarce. You have been trapped within this FALSE paradigm. Here’s the beauty of being alive in the 21 st century; someone already...

Ngày tải lên: 07/03/2014, 20:20

40 484 0
Báo cáo khoa học: The signature amidase from Sulfolobus solfataricus belongs to the CX3C subgroup of enzymes cleaving both amides and nitriles Ser195 and Cys145 are predicted to be the active site nucleophiles pot

Báo cáo khoa học: The signature amidase from Sulfolobus solfataricus belongs to the CX3C subgroup of enzymes cleaving both amides and nitriles Ser195 and Cys145 are predicted to be the active site nucleophiles pot

... PSEDATVVKRLLAAGATVVGKSVCEDLCFSGASFTSASGAVKNPWDLARNAGGSSSGSAV 177 ZP_00124054 PSEDATVVKRLLAAGATVIGKSVCEDLCFSGASFTSATGAVKNPWDLTRNAGGSSSGSAV 177 BAC99079 PSRDATVVTRLLAAGATVAGKAVCEDLCFSGSSFTPASGPVRNPWDPQREAGGSSGGSAA ... PSRDATVVTRLLAAGATVAGKAVCEDLCFSGSSFTPASGPVRNPWDPQREAGGSSGGSAA 177 CAD36560 PSRDATVVTRLLAAGATVAGKAVCEDLCFSGSSFTPASGPVRNPWDRQREAGGSSGGSAA 177 S38270 PRYDATVVRRLLDAGATITGKAVCEDLCFSGASFTSHPQPVRNPWDESRITGGSSSGSGA 177 P27765 PGFDATVVTRLLDAGATILGKATCEHYCLSGGSHTSDPAPVHNPHRHGYASGGSSSGSAA ... recombinant SsAH-WT remains active at 70 °C for about 6 days and has a half-life of 5 h at 95 °C (data not shown). We found that SsAH-WT is able to convert both amides and nitriles, and in particular...

Ngày tải lên: 07/03/2014, 21:20

9 478 0
Báo cáo Y học: What does it mean to be natively unfolded? pptx

Báo cáo Y học: What does it mean to be natively unfolded? pptx

... binding MSCRAMMs are induced by ligand bindin g. J. Biol. Chem. 271, 1379±1384. 90. Nakajo , S., Omata, K., Aiuchi, T., Shib ayama, T., Okahash i, I., Ochiai, H., Na kai, Y., Nakaya, K. & Nakamura, ... G.V., Kihara, H., Kotova, N.V., Kimura, K., Amemiya, Y., Wakabayashi, K., Serdyuk, I.N., Timchenko, A. A., Chiba, K., Nikaido, K., Ikura, T. & Kuwajima. K. (1996) Protein globularization d ... & Fink, A. L. (2001) Metal-triggered s truc- tural transformations, aggregation and đbril formation of human alpha-synuclein. A possible m olecular link between Park inson's disease and...

Ngày tải lên: 08/03/2014, 16:20

11 469 0
Adenoids: What They Are, How To Recognize Them, What To Do For Them ppt

Adenoids: What They Are, How To Recognize Them, What To Do For Them ppt

... condition that parents should learn something about adenoids and their treatment. WHAT ARE ADENOIDS? [Illustration] Inasmuch as adenoids are tucked away up behind the palate, and are therefore ... was produced from images generously made available by The Internet Archive/American Libraries.) ADENOIDS WHAT THEY ARE HOW TO RECOGNIZE THEM WHAT TO DO FOR THEM Adenoids: What They Are, How To ... few months' delay may cause considerable malformation of the jaws, palate, nose, and face. [Illustration] Study the above photographs of the same patient before and after treatment for adenoids....

Ngày tải lên: 15/03/2014, 20:20

8 424 0
How to Be a Successful Life Coach: A Guide to Setting Up a Profitable Coaching Business docx

How to Be a Successful Life Coach: A Guide to Setting Up a Profitable Coaching Business docx

... their managers. & You can attend a course which offers a formal qualification such as a diploma. & You can gain hands-on coaching experience – as a manager, as a volunteer or as a self-employed ... lives. At the same time it is unfair to engage with a client who you believe to be too vulnerable or distressed to benefit from coaching and unethical to pretend that coaching is an adequate means ... self-employed coach. Employer training My first coaching skills training took place when I was a manager in a large voluntary sector organisation. The organisation wanted to improve its pool of applicants...

Ngày tải lên: 17/03/2014, 17:20

240 798 3
w