... in the presence of inhibitor, v0 is the initial velocity in the absence of inhibitor but with (2%) dimethylsulfoxide The IC50 value was determined by tting the percent inhibition versus inhibitor ... concentration) Percent inhibition was calculated using the equation [(1 (vi v0)] ã 100, where vi is the initial ab ỵ cxd b ỵ xd 2ị Activity at varying pH For determination of optimum pH, the in vitro ... have their self-cleavage site in the region around the catalytic serine, unlike in E coli LepB, where it is located in a hydrophilic domain connecting the two transmembrane domains at the N-terminus...
Ngày tải lên: 07/03/2014, 01:20
... Deletions in the basic regions within the N-terminal domain of hnRNP I and nPTB inhibit nuclear import and/or accumulation and reduces importin a binding This conclusion fits with the in vitro binding ... displays significant binding to importin a, which is diminished or eliminated by mutations in both basic stretches The present data support the model for the recognition of bipartite NLS derived ... optimally for the recognition of five lysine or arginine residues, while the smaller binding site allows specific recognition of two basic residues, and the interaction is simultaneous at both sites...
Ngày tải lên: 18/03/2014, 01:20
Tài liệu Báo cáo khoa học: ¨ Induction of Kruppel-like factor 4 by high-density lipoproteins promotes the expression of scavenger receptor class B type I pptx
... supplemented with 10% heat-inactivated fetal bovine serum, mm glutamine and an antibiotic–antimycotic mix in a humidified incubator with 5% CO2 and 95% air Differentiation into macrophages was achieved in ... endothelial activation in response to proinflammatory stimuli [2] Overexpression of KLF4 in J774a macrophages induced the macrophage activation marker inducible nitric oxide synthase and inhibited the ... atherosclerosis in apolipoprotein E-deficient mice, and KLF2 played an important role in primary macrophage foam cell formation via the potential regulation of the key lipid binding protein adipocyte protein...
Ngày tải lên: 18/02/2014, 04:20
Tài liệu Báo cáo khoa học: The localization of FGFR3 mutations causing thanatophoric dysplasia type I differentially affects phosphorylation, processing and ubiquitylation of the receptor pptx
... immunoprecipitated with an anti-FGFR3 serum then immunoblotted with anti-ubiquitin and anti-FGFR3 sera (D) Disabling the c-Cbl ubiquitylating activity does not affect the ubiquitylation of the wild -type, ... maturation and distribution of the K650M mutant The kinase activity of FGFRs, including FGFR3 [37,38], is inhibited by SU5402, which binds to the kinases’ ATP-binding site [39] We therefore determined ... The E3-ubiquitin ligase c-Cbl is directly involved in the ubiquitylation of several RTKs [24–26,32] and may participate in the downregulation of FGFR1 via an indirect interaction with the phosphorylated...
Ngày tải lên: 19/02/2014, 00:20
Báo cáo khoa học: Copper-containing nitrite reductase fromPseudomonas chlororaphis DSM 50135 Evidence for modulation of the rate of intramolecular electron transfer through nitrite binding to the type 2 copper center pot
... The protein was fully reduced with dithionite and reoxidized stepwise with ferricyanide The spectra of the initial as-puried and the nal reoxidized forms are virtually identical, which demonstrates ... 2) which suggests the existence of modications in the catalytic center of the enzyme These modications may be attributed to either the presence of the substrate and/or a product in the vicinity ... for the Al xylosoxidans NCIB 11015 protein [1] The pI determined for Ps aureofaciens Cu-Nir is 6.05, which is clearly inside the interval obtained for the Cu-Nir in study Copper quantication yielded...
Ngày tải lên: 07/03/2014, 15:20
Đề tài " The best constant for the centered Hardy-Littlewood maximal inequality" ppt
... Ili ,i ∪Ii,li +1 ∪· · ·∪Ii ,i ∪Ii ,i+ 1 ∪· · ·∪Ii,ri (ii) For any i the nonempty of the closed intervals I1 ,i , , Ili −1 ,i and Ii,ri +1 , , Ii,n (if any) are pairwise disjoint and each of them ... satisfies the conditions in Proposition 1(ii), that is the separability inequalities and the connectedness of E(µ), will be called admissible It is clear that for any admissible µ the intervals Ii,j ... (respectively with s = i, then clearly |Ji ∩ Js s i + ˜ |Js ∩ Ji− | = ks for any li ≤ s < i) and so writing Ii,s = [yi + Kis−1 , yi + Kis ] i i ˜ ⊆ Ii,s (respectively Is ,i = [yi − Ks , yi − Ks+1 ] ⊆ Is,i...
Ngày tải lên: 14/03/2014, 22:20
Báo cáo khoa học: Enzymatic oxidation of NADP+ to its 4-oxo derivative is a side-reaction displayed only by the adrenodoxin reductase type of ferredoxin-NADP+ reductases potx
... when excited with light in the UV region This observation is relevant for excluding the presence of species modified in position of the nicotinamide ring, because, unlike the compounds with the oxo ... transient intermediate suggests that water molecule addition to the nicotinamide moiety (Fig 1) might be the limiting step of the whole reaction Investigating the role of Glu214 and His57 of FprA in the ... occupancy of the nicotinamide ring of the bound ligand in the active site [14] In this view, it is significant that the perturbations induced by NADPO binding to FprA were more intense than those induced...
Ngày tải lên: 16/03/2014, 11:20
Báo cáo khoa học: Mutational analysis of substrate recognition by human arginase type I ) agmatinase activity of the N130D variant pot
... are indicated by the numbers on the right side The migration of the protein markers is indicated by pencil marks on the membrane The arrow indicates the position of the wild -type and N130D variants ... arginine inhibition and Ki value for ornithine inhibition of the N130D variant The large effect of the Asn130 fi Asp mutation on the kcat value indicates that arginine is not correctly positioned ... respectively The Table Kinetic properties of the wild -type and N130D variants of human arginase I The inhibitors used were ornithine (orn) and guanidinium chloride (Gdn) Substrate Arginine Agmatine...
Ngày tải lên: 16/03/2014, 12:20
Báo cáo khoa học: Type I receptor binding of bone morphogenetic protein 6 is dependent on N-glycosylation of the ligand pdf
... derived from E coli expression is inactive in these cells, probably due to its lack of binding to ActR -I (B) Signaling of BMP-6 and BMP-7 via ActR -I is shown in the inhibition of proliferation in ... ActR -I and ActR-II are faster (kon > 105ÆM)1Æs)1, koff > 10)1Æs)1), impeding the analysis of the dissociation rate and thus requiring analysis of the equilibrium binding ActR -I, is inactive in ... requirement for BMPR-IA or BMPR-IB E coli-derived BMP-6 is also inactive, due to its inability to bind ActR -I; the green dashed line indicates maximal proliferation in the absence of any BMP ligand...
Ngày tải lên: 23/03/2014, 07:20
Báo cáo khoa học: Kinetics of the quinone binding reaction at the QB site of reaction centers from the purple bacteria Rhodobacter sphaeroides reconstituted in liposomes docx
... obtained in saturating conditions in liposomes, indicating a relative stabilization of Q À This difference in the semiquinone stability might be B associated with small detrimental changes in the ... located in the channel into which the quinone isoprenoid chain sits in the enzyme This explains the slow exchange process of the quinone at its binding site Conversely, the dimensions of Triton ... of the quinone, between the protein interior and the bilayer Some considerations regarding the exchange reaction for the oxidized quinone are made in this paper, based on investigations into the...
Ngày tải lên: 30/03/2014, 20:20
Báo cáo Y học: Exploring the primary electron acceptor (QA)-site of the bacterial reaction center from Rhodobacter sphaeroides Binding mode of vitamin K derivatives pptx
... gained substantial interest as they bind tightly to the QA site, enabling its functional reconstitution while retaining the native ubiquinone at QB [16,17] The difference in the semiquinone anion ... In contrast, the positions of the isoprenoid chains differ significantly beyond the first two isoprene units As both, the binding affinity and the midpoint redox potential of the quinone are mainly ... K1, which is a naphthoquinone derivative The aromatic interactions of the naphthoquinone with the QA binding site in contrast to ubiquinone might be the reason for the failure of ubiquinone to...
Ngày tải lên: 31/03/2014, 21:21
Báo cáo sinh học: " The E5 protein of the human papillomavirus type 16 down-regulates HLA-I surface expression in calnexin-expressing but not in calnexin-deficient c" pptx
... colocalisation and immunoprecipitation of the viral protein with calnexin, and also of that with the heavy chain of HLA -I Discussion Eukaryotic cells respond to viral infection by activating mechanisms ... antibodies against different tagged versions of the E5 protein or against calnexin demonstrate that HPV16 E5 associates with calnexin in vitro The biological significance of this interaction is ... MDTYRYITNLDTASTTLLACFLLCFCVLLCVCLLIRPLLLSVSTYTSLIILVLLLWITAASAFRCFIVYIIFVYI PLFLIHTHARFLIT M1 MDTYRYITNLDTASTTLpACFLdCFCV rLCVCLLIRPLLLSVSTYTSLIILVLLLWITAASAFRCFI VYIIFVYI PLFLIHTHARFLIT M2 MDTYRYITNLDTASTTLLACFLLCFCVLLCVCLLIRPLLLSVSTYTSpIIdV...
Ngày tải lên: 18/06/2014, 18:20
báo cáo hóa học: " Clinical usefulness of the screen for cognitive impairment in psychiatry (SCIP-S) scale in patients with type I bipolar disorder" doc
... [24] The present investigation was designed to assess the sensitivity, reliability and validity of the SCIP for detection and quantification of cognitive impairment in euthymic patients suffering ... patients with and without cognitive impairment In sum, the SCIP produced a valid quantification of cognitive status in bipolar patients by psychiatrists with minimal training on the tool, and the ... similar tools, and the current prospective evaluation provides the first demonstration supporting the feasibility, reliability, and validity of the Spanish version of the SCIP (SCIP-S) in a bipolar...
Ngày tải lên: 18/06/2014, 19:20
Báo cáo hóa học: " The E5 protein of the human papillomavirus type 16 down-regulates HLA-I surface expression in calnexin-expressing but not in calnexin-deficient cells" ppt
... colocalisation and immunoprecipitation of the viral protein with calnexin, and also of that with the heavy chain of HLA -I Discussion Eukaryotic cells respond to viral infection by activating mechanisms ... antibodies against different tagged versions of the E5 protein or against calnexin demonstrate that HPV16 E5 associates with calnexin in vitro The biological significance of this interaction is ... MDTYRYITNLDTASTTLLACFLLCFCVLLCVCLLIRPLLLSVSTYTSLIILVLLLWITAASAFRCFIVYIIFVYI PLFLIHTHARFLIT M1 MDTYRYITNLDTASTTLpACFLdCFCV rLCVCLLIRPLLLSVSTYTSLIILVLLLWITAASAFRCFI VYIIFVYI PLFLIHTHARFLIT M2 MDTYRYITNLDTASTTLLACFLLCFCVLLCVCLLIRPLLLSVSTYTSpIIdV...
Ngày tải lên: 20/06/2014, 01:20
Báo cáo hóa học: " Respiratory syncytial virus (RSV) attachment and nonstructural proteins modify the type I interferon response associated with suppressor of cytokine signaling (SOCS) proteins and IFN-stimulated gene-15 (ISG15)" potx
... antagonize type I IFN activity by inhibiting the type I IFN and the signaling cascade [10,29], the results indicate that SOCS3 may not have an essential role governing type I IFN during RSV infection, ... (Figure 1A) This finding is in keeping with the findings of NS1/NS2 antagonism of type I IFNs [4,46,47] and suggests the possibility that type I IFN antagonism is linked to NS1/NS2 induction of SOCS1 ... virus infection of MLE-15 cells, it is unlikely NS1/ NS2 has a role in modifying ISG15 The finding in this study that G protein expression inhibits IFNβ and ISG15 protein expression is consistent...
Ngày tải lên: 20/06/2014, 01:20
Báo cáo hóa học: " Research Article A Multiple Hilbert-Type Integral Inequality with the Best Constant Factor" doc
... sin(π/ p))2p is the best possible At present, because of the requirement of higher-dimensional harmonic analysis and higher-dimensional operator theory, multiple Hilbert -type integral inequalities ... inequalities have been studied Hong [10] obtained the following If n = 1, pi i= 1 a > 0, ri = pi > 1, pi n pi , λ> i =1 1 n−1− , a ri i = 1,2, ,n, (1.6) then ∞ α ··· ∞ α n n i =1 xi − α a λ fi xi dx1 ... Peˇ ari´ , and A M Fink, Inequalities Involving Functions and Their Intec c c grals and Derivatives, vol 53 of Mathematics and Its Applications (East European Series), Kluwer Academic Publishers,...
Ngày tải lên: 22/06/2014, 18:20
Báo cáo y học: "Systemic lupus erythematosus and the type I interferon system" docx
... for therapy and to maintain remissions in SLE patients This drug is known to inhibit IFN-α production by NIPCs/PDCs in vitro by the inhibition of endosomal acidification/maturation [23] The proposed ... comprises the inducers of type I IFN synthesis, the type I IFN genes and proteins, the cells producing type I IFNs, and the target cells affected by the IFNs The human type I IFN gene family contains ... observations obviously further raise the question of whether the type I IFN system could be involved in the etiopathogenesis of naturally occurring SLE The type I IFN system The type I IFN system...
Ngày tải lên: 09/08/2014, 01:21
Báo cáo y học: "Interactions among type I and type II interferon, tumor necrosis factor, and -estradiol in the regulation of immune response-related gene expressions in systemic lupus erythematosus" potx
... cells in vitro The expression of 15 IFI genes (IFIT1, IFIT3, IFIT5, IFI6, IFI16, IFI27, IFI30, IFI35, interferon-induced transmembrane protein 1, ISG15, IRF7, OAS1, OASL, GBP1, and GBP2) in PBMCs ... statistically significant differences in the mRNA expression levels between the SLE patient and healthy individual groups The criterion for the statistical significance was P < 0.05 Results Immune ... on IFI gene expressions, although with some exceptions like IFIT1 (Figure 4b) IFIT1 was downregulated upon IFN and IFN co-stimulation, unlike stimulation with IFN alone E2 showed no significant...
Ngày tải lên: 09/08/2014, 01:22
Báo cáo y học: " Characterisation of the immune response to type I collagen in scleroderma" pps
... induction to type I collagen (CI) significantly reduces the skin score in patients with diffuse systemic sclerosis (SSc) with late-phase disease Results of a NIAMS/ NIAID multicenter phase II ... G: Investigation of type I and type III collagens of the lung in progressive systemic sclerosis Arthritis Rheum 1981, 24:625-631 White B: Immunopathogenesis of systemic sclerosis Rheum Dis Clin ... S, Mirarchi A, Spiera H, Sasaki T, Shoichi O, Takeuchi K, Pandey JP, et al.: Autoantibodies to the extracellular matrix microfibrillar protein, fibrillin-1, in patients with scleroderma and other...
Ngày tải lên: 09/08/2014, 08:22
Báo cáo y học: "Adipose-derived mesenchymal stem cells from the sand rat: transforming growth factor beta and 3D co-culture with human disc cells stimulate proteoglycan and collagen type I rich extracellular matrix" ppsx
... chondrogenic differentiation was confirmed using standard methods described below Osteogenic differentiation Osteogenic differentiation of stem cells using an osteogenesis kit (Chemicon International, ... production using the DMB assay [26] Scoring of immunohistochemistry and toluidine blue staining Scoring of slides from immunohistochemical staining of cellsurface markers, ECM proteins and toluidine ... (AAPER, Shelbyville, KY) until processed for paraffin embedding The CD antibodies work to identify cells by immunohistochemical visualisation CD surface marker identification, along with Page of...
Ngày tải lên: 09/08/2014, 10:23