the asiapacific a region in transition

Ngày tải lên: 24/12/2013, 23:11

... everyday matters and problems in local commercial life. In the land tax, the assessed taxes and the income tax, local knowledge formed the acknowledged basis of the administrative machinery. ... national emergency, generally war.  e principal direct tax was the land tax, ori- ginally a tax on real and personal property and incomes 20 but it became a tax purely on land in the nature ... subordinate sta was fundamental to the authority and e cacy of the tax tribunals, and in its own right reinforced the safeguard to the taxpayer. It was of real import- ance in the absence of the rigorous...

Ngày tải lên: 18/02/2014, 11:20

... abundance was estimated from the area of molecular ion peak relative to the total area (expressed as percentage). Peaks representing less than 5% of the base peak are not included in the table. ... other. These are 1209 and 1207 obtained from the same otitis media patient on the same day (left and right ear isolates) and 1233 obtained from another patient on a different date. The structural ... a very low amount of Neu5Ac in neuraminidase-treated LPS- OH samples of strain 1233lpsA (as detected by high- performance anion-exchange chromatography), indicated that an identical sialyl-lacto-N-neotetraose...

Ngày tải lên: 08/03/2014, 08:20

... configur- ation. The structure of the oligosaccharide backbone was determined using either alkaline or acid hydrolysis. Alkaline treatment, aimed at recovering the complete carbohydrate backbone, was carried ... Thomas-Oates, J.E. & Brade, H. (1994) Preparation and structural analysis of oligosaccharide monophosphates obtained from the lipopolysaccharide of recombinant strains of Salmonella minnesota ... 4,6-disubstituted-HexN and, in small amounts, terminal-Rha and 6-substituted-Glc. In addition, the disaccharide 7-O-carbamoyl-Hep-(1fi3)- Hep was found. Fatty acid analysis revealed the presence of typical fatty acids...

Ngày tải lên: 19/02/2014, 13:20

... shorter in DK9 (20 min) than in the WT form (33 min). Characterization of stabilizing interactions between A- and B-chains In WT thrombin, the A- chain assumes an overall boomerang-like shape interacting ... experimentally. In analogy with the values calculated in enzymatic experiments, an increase of % 0.5 pK units of the His57 in DK9 mutant was also calculated analyzing the NAPAP data set (Table 1C). In ... Brønsted theory on acid ⁄ base-catalyzed reactions indicated that in the thrombin amidase cycle the His57 imidazolium form acts as a general acid to facilitate amine expulsion from the tetrahedral interme- diate,...

Ngày tải lên: 07/03/2014, 12:20

... Comparative microarray analysis of Arabidopsis thaliana and Arabidopsis halleri roots identi- fies nicotianamine synthase, a ZIP transporter and other genes as potential metal hyperaccumulation factors. Plant ... 1:MFFIDVLWKLFPLYLFGSERDYLSETESILKIVPETMAAASSLSILCDAGEPDLCRDDSAAFLLKLVAIASIF T jZNT1 37:LAGVAGVAIPLIGKNRRFLQTEGNLFVAAKAFAAGVILATGFVHMLAGGTEALTNPCLPDYPWSKFPFPGFFA T jZNT2 74:LAGAAGVAIPLIGRNRRFLQTDGSLFVAAKAFAAGVILATGFVHMLAGGTEALTNPCLPEFPWKKFPFPGFFA T jZNT1 110:MVAALITLIVDFMGTQYYESKQQRNEVAGGGEAADVVEPGREETS-SVVPVVVERGNDDSKVFGEEDGGGMHI T jZNT2 ... 322–330. 2 Kra ¨ mer U, Talke I & Hanikenne M (2007) Transition metal transport. FEBS Lett 581, 2263–2272. 3 Tomatsu H, Takano J, Takahashi H, Watanabe-Takah- ashi A, Shibagaki N & Fujiwara T...

Ngày tải lên: 29/03/2014, 00:20

... amino acid analysis and N-terminal Edman sequencing (data not shown). MS analysis showed that the isolated CT-peptide had a molecular mass within 1 Da of the computed mass 17635.9 Da (average) (data not ... cells expressing the recombinant mPC1 ⁄ 3, the presence of the 87 kDa form in excess of the 66 ⁄ 71 kDa facilitates isolation of the enzyme and helps in maintaining the enzymatic activity at a proper ... cleavages of the initial preproPC1 ⁄ 3. Following removal of the signal peptide, autocatalytic cleavage occurs in the early secretory pathway at the C-termi- nus of the proregion, following the...

Ngày tải lên: 30/03/2014, 08:20

... Brownstein Z, Marlin S, Adina Q, Cockburn DJ, Pandya A, Siemering KR, Chamberlin GP, Ballana E, Wuyts W, Maciel-Guerra AT, Alvarez A, Villamar M, Shohat M, Abeliovich D, Dahl HH, Estivill X, Gasparini ... with normal hearing using a com- mercially available DNA extraction kit (Watson Bio- technologies Inc., Shanghai, China). Mutational analysis The coding exon (exon 2) and flanking intronic regions ... 64(1):65-69. 33. Najmabadi H, Nishimura C, Kahrizi K, Riazalhosseini Y, Malekpour M, Daneshi A, Farhadi M, Mohseni M, Mahdieh N, Ebrahimi A, Bazazzadegan N, Naghavi A, Avenarius M, Arzhangi S, Smith...

Ngày tải lên: 18/06/2014, 16:20

Ngày tải lên: 20/06/2014, 01:20

Ngày tải lên: 20/06/2014, 08:20

... which quarterly data series are available for most of the sample period. They are Korea, Japan, Indonesia, Thailand, the Philippines, Singapore, Taiwan, Australia, and New Zealand. 17 Data sources ... current (and lagged) real GDP since changes in the real GDP may affect the capital account. For example, an increase in the real GDP may attract more capital, and improve the capital account. ... and whether capital flows help explain the synchronization of the business cycles in the Asian countries. Capital flows, especially after the financial market liberalization, may increase the...

Ngày tải lên: 24/10/2012, 09:27

... communicated by the switchboard operators through the hospital loudspeakers and paging system, and a detailed log of all calls is maintained. Criteria for medical emergency team activation Calling ... impor- tant to gain insight into the possible processes that lead to MET calls and to understand their circadian variation in order to plan appropriate staff allocation. We recently reported that the ... this to aspects of nursing and medical daily routine. Materials and methods The hospital Austin Health is a university-affiliated teaching hospital with three hospital campuses situated in Melbourne,...

Ngày tải lên: 25/10/2012, 10:45

... preliminary human and animal trials have shown it to be effective in treating osteoarthritis (OA). The present clinical trial evaluated the safety and efficacy of UC-II as compared to a combination ... currently available for OA, individualized treatment programs are available to help relieve pain and stiffness, and to maintain and/or improve func- tional status. In the last few years, various ... Subject using other therapies for OA, such as exercise, heat/cold therapy, joint protection and physiotherapy/occupational therapy agrees to continue these therapies as normal avoiding changes in frequency...

Ngày tải lên: 26/10/2012, 09:48

... epithelium in the teratoma (Table 1), a finding we have also made in a study on colorectal carcinoma [34]. The tissue showed mucin of predominantly the acidic type, the sulphated type dominating ... 2 with the signa- ture amino acids for mucins, namely, serine, threonine and proline comprising 48.3% of the total amino acids in the sample. The threonine levels in this particular case were ... human ovarian mucinous cyst. These monoclonal antibodies exclusively stained the surface gastric epithelium of normal human gastro-intestinal tract and reacted with fetal, precancerous and cancer- ous...

Ngày tải lên: 26/10/2012, 10:03