... dark green and shining above, the margins recurved: flowers in clusters terminating the branch- lets: petals i/> in. long including the recurved tips, nearly black: fruiting peduncle stout, ... Publications in Botany. [VOL. 4 14 in. wide, obscurely 1- or 3-nerved: flowers pink or rose-color, in dense terminal heads 1 in. or more in diameter, the axis seldom growing out before flowering is ... the minute foliage: leaves exceedingly minute, mostly in whorls of 3, closely appressed to the stem, ovate, scale-like: flowers in small globular heads about y± in- in diameter: capsules in...
Ngày tải lên: 13/02/2014, 12:20
Tài liệu A Designer’s Log Case Studies in Instructional Design pptx
... participating in the design process: O = organizational P = personal 4. Time-to-delivery: 1 = course already begun or is about to begin 2 = beginning in between 2 and 4 months 3 = beginning in more ... engineering in design, a useful technique in cases where it is dicult to identify the objectives a faculty member actually wishes to set or in cases where the professor is not inclined to invest ... working with subject matter experts who were intent on oering their courses at a distance and/or online. Finally, I wish to recognize Valerie Cliord () for an inspiring book review in...
Ngày tải lên: 17/02/2014, 06:20
Tài liệu Studies in Public Regulation doc
... opposed regulations affecting local industry. An obvious rationale for the relative unimportance of variations in compliance costs in explaining congressional voting is that intraindustry impacts were ... producers, but would influence the marginal economics of this industry. By influencing marginal eco- nomics, it would significantly impact the quasirents of existing producers —indeed, it would likely ... important both in determining the total cost of imposing regulations and in affecting the structure of the industry. For example, if short-run effects fall predomi- nantly on small, marginal producers,...
Ngày tải lên: 17/02/2014, 10:20
Tài liệu PROJECT MANAGEMENT INSTITUTE CASE STUDIES IN PROJECT MANAGEMENT: THE CHUNNEL PROJECT ppt
... planning, definition and design, formulation, the formal approach, preliminary engineering, and preliminary design. It covers project organizing, planning, scheduling, estimating, and budgeting. ... disputes. Several arbitration bodies, including the International Chamber of Commerce, were involved to help bring the various competing sides to the bargaining table in an attempt to resolve key portions ... realizing the risks involved and setting up the original RFP with the objective of rewarding the “promoters”—and, in turn, the contractors at all levels—for achieving the goals determined by...
Ngày tải lên: 18/02/2014, 10:20
Tài liệu Studies in Legal History pdf
... eliminating church court jurisdictions. Aggressive justices were completely involved in the realm of government and politics, since law was the primary instrument the state had to maintain or ... the transformation of life taking place in the locality. Bishops found themselves completely subordinated to the crown, but in a better position to regulate parish life. Inserting the rector back into the parish ... around the king necessarily reverberated in mundane parish life. Law wove the local situation together with the events instituted in London and Westminster. In some ways over the preceding century...
Ngày tải lên: 18/02/2014, 13:20
Tài liệu Enterprise and Culture: Routledge Studies in Small Business doc
... theory (increased earnings coming from additional investment in training and education) do not hold in the secondary sector (King, 1990), a series of awareness and training programmes continue to ... hereafter invented, including photocopying and recording, or in any information storage or retrieval system, without permission in writing from the publishers. British Library Cataloguing in Publication ... net increase in self-employment over 1979–91, though that meant an 80 per cent increase in self-employment in the manufacturing industries (Employment Gazette, 1991). The increase in manufacturing...
Ngày tải lên: 19/02/2014, 21:20
Tài liệu PHD AND MASTER’S STUDIES IN ECONOMIC, ACCOUNTING AND BUSINESS HISTORY. pdf
... tosixyears0.ThePhD involvesindependentresearchwhichisundertakenundertheguidanceofoneormoresupervisors. NewZealandPhDsfollowtheBritishmodelofbeingawardedonthethesisalong;thethesiswillbe 100,000wordsandmustmakeasignificantandoriginalcontributiontothediscipline. OURACADEMICSTAFFHAVESPECIALISTKNOWLEDGE IN ANUMBEROFAREASINCLUDING: • InternationaleconomicandbusinesshistoryincludingtheAsia‐Pacificregion • ... nSACL) http://www/Victoria.ac.nz/sacl/ MA.History(withinHistory) http://www/victoria.ac.nz/history Forfurtherinformationsee http://www.victoria.ac.nz/fgr/prospective‐phds and http://www.victoria.ac.nz/fgr/masters TheEconomic,AccountingandBusinesshistoryNetworkalsorunsaseminarseries,producesworking papersandhaslinkstoanumberofresearchinstitutionsaroundtheworld.Formoreinformation pleasevisitourwebsite http://www.victoria.ac.nz/sef/research NETWORKCOORDINATOR DrLarryLepper SchoolofEconomicsandFinance Email:larry.lepper@vuw.ac.nz Phone:+64021460585 STUDENTANDACADEMICSERVICES Phone:+6444635376 Fax:+6444635360 Email:fca‐sa0@vuw.ac.nz Level1,RailwayWestWing Pipiteacampus Wellington6011 NewZealand VictoriaUniversityofWellington POBox600 Wellington6140 NewZealand INTERNATIONALSTUDENTCONTACT VictoriaInternational Phone:+6444635350 Fax:+6444635056 Email: Victoria‐international@vuw.ac.nz Website:http://www.victoria‐international.ac.nz PHDANDMASTER’S STUDIES IN ECONOMIC,ACCOUNTINGAND BUSINESSHISTORY. Economic,AccountingandBusinessHistoryNetwork(BEAN) VictoriaUniversityofWellington,NewZealandisaleadingresearchandlearningcentre in theAsia‐ Pacificregionforthestudyofeconomic,accountingandbusinesshistory. Atotalof10academicsstaffworking in theseareasaretobefound in theSchoolofEconomicsand Finance(SEF);theSchoolofAccountingandCommercialLaw(SACL);andtheSchoolofHistory, Philosophy,PoliticalScienceandInternationalRelations(History). TheuniversityoffersMaster’sandPhDdegrees in economics,history,accountingandhistory.Students canchoosetopics in economicsaccountingandbusinesshistoryforthosedegr ... nSACL) http://www/Victoria.ac.nz/sacl/ MA.History(withinHistory) http://www/victoria.ac.nz/history Forfurtherinformationsee http://www.victoria.ac.nz/fgr/prospective‐phds and http://www.victoria.ac.nz/fgr/masters TheEconomic,AccountingandBusinesshistoryNetworkalsorunsaseminarseries,producesworking papersandhaslinkstoanumberofresearchinstitutionsaroundtheworld.Formoreinformation pleasevisitourwebsite http://www.victoria.ac.nz/sef/research NETWORKCOORDINATOR DrLarryLepper SchoolofEconomicsandFinance Email:larry.lepper@vuw.ac.nz Phone:+64021460585 STUDENTANDACADEMICSERVICES Phone:+6444635376 Fax:+6444635360 Email:fca‐sa0@vuw.ac.nz Level1,RailwayWestWing Pipiteacampus Wellington6011 NewZealand VictoriaUniversityofWellington POBox600 Wellington6140 NewZealand INTERNATIONALSTUDENTCONTACT VictoriaInternational Phone:+6444635350 Fax:+6444635056 Email: Victoria‐international@vuw.ac.nz Website:http://www.victoria‐international.ac.nz PHDANDMASTER’S STUDIES IN ECONOMIC,ACCOUNTINGAND BUSINESSHISTORY. Economic,AccountingandBusinessHistoryNetwork(BEAN) VictoriaUniversityofWellington,NewZealandisaleadingresearchandlearningcentre in theAsia‐ Pacificregionforthestudyofeconomic,accountingandbusinesshistory. Atotalof10academicsstaffworking in theseareasaretobefound in theSchoolofEconomicsand Finance(SEF);theSchoolofAccountingandCommercialLaw(SACL);andtheSchoolofHistory, Philosophy,PoliticalScienceandInternationalRelations(History). TheuniversityoffersMaster’sandPhDdegrees in economics,history,accountingandhistory.Students canchoosetopics in economicsaccountingandbusinesshistoryforthosedegr...
Ngày tải lên: 20/02/2014, 17:20
Agency for Toxic Substances and Disease Registry Case Studies in Environmental Medicine (CSEM) Lead Toxicity pptx
... tracked into homes in significant quantities from exterior soil that was contaminated by historical use of lead in paint, gasoline, or industries. Drinking Water Lead occurs in drinking water ... cited in AAP 1993) • grinding or cutting equipment during processing Packaging Lead in packaging may contaminate food. • Bright red and yellow paints on bread bags and candy may contain lead ... Historic or ongoing lead-related industries (including mining and smelting) can result in high lead levels in surrounding soil. Progress Check 2. In older urban areas, most of the lead in the environment...
Ngày tải lên: 05/03/2014, 10:20
Systematic reviews of test accuracy studies in reproductive health docx
... cross-sectional studies. In such studies, methodological quality may be defined as the confidence that the study design, conduct and analysis has minimised biases in estimating the accuracy of the test in ... reference test. In addition, accuracy studies require that observers assessing gold standards verifying the diagnosis be blinded to measurements obtained from the test and vice versa. Blinding avoids ... However potentially misleading summary LRs might be obtained from pooling LRs obtained from studies with extreme and diverging prevalence. An alternative way of summarising the average performance...
Ngày tải lên: 05/03/2014, 17:20
Studies in Health Technology and Informatics pptx
... Outside of a Clinic Visit? Table 2 - Recommended actions occurring following clinical message indicating new family history information New information provided by patients led to an increased risk ... Brazil xxvii Discovering New Biomedical Knowledge: Machine Learning and Data Mining Biomedical Knowledge Discovery with Topological Constraints Modeling in Bayesian Networks: A Preliminary Report 560 ... Online® search results for Sodium To minimize maintenance and gain sensitivity of the infor- mation retrieved given a variety of user interests, the information hyperlink avoids tight coupling...
Ngày tải lên: 06/03/2014, 12:20
ROUTLEDGE STUDIES IN SCIENCE, TECHNOLOGY AND SOCIETY: Human-animal relations and the rise of veterinary medicine pot
... and discipline in other domains. In addition to changes in individual conduct and power relations within human societies, the transitions from foraging to farming and hunting to herding had significant repercussions ... found in cosmetics. Moisturising creams, for instance, often contain collagen or the animal proteins reticulin and elastin; hair conditioners are made using keratin, an animal protein obtained ... change in theological thinking, from the mid-eighteenth century onwards, there was increasing interest in the welfare of the animals used by human society, which in turn was supported b y a growing...
Ngày tải lên: 06/03/2014, 16:20
Fundamental Studies in Business and Entrepreneurship 2012-2013 doc
... the business plan as preparation for launching a business venture, managing the business and obtaining investor dollars. Finances for Entrepreneurs and Small Business Owners Every budding entrepreneur ... important information about applying for your visa, paying your fees, and enrolling in Fundamental Studies in Business and Entrepreneurship. Please be sure to carefully read this information, ... and develop your interviewing skills. Securing the internship requires interviewing for the position, just as you would interview for a full-time job. Once you obtain an internship, a program...
Ngày tải lên: 06/03/2014, 19:20
CASE STUDIES IN PHARMACEUTICAL PROJECT MANAGEMENT: A TECHNICAL FORUM potx
... transfer. The project required the following: •A complete renovation of a formulation and filling suite, including a new separate air-handling system Case Studies in Pharmaceutical Project Management A ... project management in outsourcing, several industry members provided case studies on how to coordinate, organize, and implement a successful project. Blow/fill/seal manufacturing Norman Weichbrodt, ... manufacturing team. Execution. To date, all of the engineer- ing, stability, and process-validation batches have met the in- process and final-product test specifications. With nine batches...
Ngày tải lên: 07/03/2014, 00:20
COLLEGE TEACHING STUDIES IN METHODS OF TEACHING IN THE COLLEGE pot
Ngày tải lên: 15/03/2014, 00:20
Case Studies in Public Budgeting and Financial Management Second Edition, Revised and Expanded pptx
Ngày tải lên: 15/03/2014, 05:20
Bạn có muốn tìm thêm với từ khóa: