sample of letter of recommendation for a family friend

Báo cáo hóa học: "Research Article Strong Convergence Theorems of Common Fixed Points for a Family of Quasi-φ-Nonexpansive Mappings" ppt

Báo cáo hóa học: "Research Article Strong Convergence Theorems of Common Fixed Points for a Family of Quasi-φ-Nonexpansive Mappings" ppt

Ngày tải lên : 21/06/2014, 20:20
... theorems of a modified hybrid algorithm for a family of quasi-φ-asymptotically nonexpansive mappings,” Journal of Computational and Applied Mathematics, in press. 25 Y. I. Alber, “Metric and generalized ... PanAmerican Mathematical Journal, vol. 4, no. 2, pp. 39–54, 1994. 27 I. Cioranescu, Geometry of Banach Spaces, Duality Mappings and Nonlinear Problems, vol. 62 of Mathematics and Its Applications, ... family of relatively nonexpansive mappings in a Banach space,” Journal of Mathematical Analysis and Applications, vol. 357, no. 2, pp. 356–363, 2009. 9 G. Lewicki and G. Marino, “On some algorithms...
  • 11
  • 270
  • 0
báo cáo hóa học:" Research Article Strong Convergence Theorems of Viscosity Iterative Methods for a Countable Family of Strict Pseudo-contractions in Banach Spaces" pot

báo cáo hóa học:" Research Article Strong Convergence Theorems of Viscosity Iterative Methods for a Countable Family of Strict Pseudo-contractions in Banach Spaces" pot

Ngày tải lên : 21/06/2014, 11:20
... Methods for a Countable Family of Strict Pseudo-contractions in Banach Spaces Rabian Wangkeeree and Uthai Kamraksa Department of Mathematics, Faculty of Science, Naresuan University, Phitsanulok ... either a p-uniformly convex Banach space which admits a weakly continuous duality mapping or a p-uniformly convex Banach space with uniformly G ˆ ateaux differentiable norm. As applications, at the ... Halpern, “Fixed points of nonexpanding maps,” Bulletin of the American Mathematical Society, vol. 73, pp. 957–961, 1967. 3 K. Aoyama, Y. Kimura, W. Takahashi, and M. Toyoda, “Approximation of...
  • 21
  • 379
  • 0
báo cáo hóa học:" Research Article Asymptotic Behavior of Equilibrium Point for a Family of Rational Difference Equations" docx

báo cáo hóa học:" Research Article Asymptotic Behavior of Equilibrium Point for a Family of Rational Difference Equations" docx

Ngày tải lên : 21/06/2014, 11:20
... software package Matlab 7.1. We have dealt with the problem of global asymptotic stability analysis for a class of nonlinear difference equation. The general sufficient conditions have been obtained ... numerical simulations are also shown to support our analytic results. 1. Introduction Difference equations appear naturally as discrete analogues and in the numerical solutions of differential and ... 2002. 2 V. L . K oc i ´ c and G. Ladas, Global Behavior of Nonlinear Difference Equations of Higher Order with Applications, vol. 256 of Mathematics and Its Applications, Kluwer Academic Publishers,...
  • 10
  • 266
  • 0
Báo cáo hóa học: " Research Article Inclusion Properties for Certain Classes of Meromorphic Functions Associated with a Family of Linear Operators" pptx

Báo cáo hóa học: " Research Article Inclusion Properties for Certain Classes of Meromorphic Functions Associated with a Family of Linear Operators" pptx

Ngày tải lên : 21/06/2014, 20:20
... associated with the Choi-Saigo-Srivastava operator,” Journal of Mathematical Analysis and Applications, vol. 320, no. 2, pp. 779–786, 2006. 17 R. W. Barnard and Ch. Kellogg, “Applications of convolution ... functions,” SIAM Journal on Mathematical Analysis, vol. 15, no. 4, pp. 737–745, 1984. 8 K. I. Noor and M. A. Noor, “On integral operators,” Journal of Mathematical Analysis and Applications, vol. ... properties of certain classes of meromorphic functions associated with a family of linear operators, which are defined by means of the Hadamard product or convolution. Some invariant properties...
  • 12
  • 290
  • 0
Báo cáo hóa học: "Research Article Some Characterizations for a Family of Nonexpansive Mappings and Convergence of a Generated Sequence to Their Common Fixed Poin" pdf

Báo cáo hóa học: "Research Article Some Characterizations for a Family of Nonexpansive Mappings and Convergence of a Generated Sequence to Their Common Fixed Poin" pdf

Ngày tải lên : 21/06/2014, 20:20
... Characterizations for a Family of Nonexpansive Mappings and Convergence of a Generated Sequence to Their Common Fixed Point Yasunori Kimura 1 and Kazuhide Nakajo 2 1 Department of Mathematical ... and Applications 20 T. Ibaraki, Y. Kimura, and W. Takahashi, “Convergence theorems for generalized projections and maximal monotone operators in Banach spaces,” Abstract and Applied Analysis, ... section, we can obtain various types of convergence theorems for families of nonexpansive mappings. 6. Generalization of Xu’s and Matsushita-Takahashi’s Theorems At the end of this paper, we remark the...
  • 16
  • 359
  • 0
Báo cáo hóa học: "Research Article A Strong Convergence Theorem for a Family of Quasi-φ-Nonexpansive Mappings in a Banach Space" pdf

Báo cáo hóa học: "Research Article A Strong Convergence Theorem for a Family of Quasi-φ-Nonexpansive Mappings in a Banach Space" pdf

Ngày tải lên : 22/06/2014, 11:20
... pages doi:10.1155/2009/351265 Research Article A Strong Convergence Theorem for a Family of Quasi-φ-Nonexpansive Mappings in a Banach Space Haiyun Zhou 1 and Xinghui Gao 2 1 Department of Mathematics, Shijiazhuang Mechanical ... I. Alber and S. Reich, “An iterative method for solving a class of nonlinear operator equations in Banach spaces,” Panamerican Mathematical Journal, vol. 4, no. 2, pp. 39–54, 1994. 12 S. Kamimura ... Netherlands, 1990. 9 W. Takahashi, Nonlinear Functional Analysis, Yokohama Publishers, Yokohama, Japan, 2000. 10 Ya. I. Alber, “Metric and generalized projection operators in Banach spaces:...
  • 12
  • 221
  • 0
Báo cáo Y học: Modeling the three-dimensional structure of H+-ATPase of Neurospora crassa Proposal for a proton pathway from the analysis of internal cavities pptx

Báo cáo Y học: Modeling the three-dimensional structure of H+-ATPase of Neurospora crassa Proposal for a proton pathway from the analysis of internal cavities pptx

Ngày tải lên : 23/03/2014, 21:20
... H + -ATPase of Neurospora crassa Proposal for a proton pathway from the analysis of internal cavities Olivier Radresa 1 , Koji Ogata 2 , Shoshana Wodak 2 , Jean-Marie Ruysschaert 1 and Erik Goormaghtigh 1 1 Service ... characterized by the formation of a covalent enzyme-aspartyl phosphate intermediate [2,3,42,43]. The 3D structures of PMA1_NEUCR and of another P-type ATPase, the Ca 2+ -ATPaseofrabbitsarcoplasmic reticulum ... Neurospora crassa plasma-membrane H + -ATPase; ATC1_RABIT, Oryctolagus cuniculus (rabbit) Ca 2+ - ATPase of sarcoplasmic reticulum (splice isoform SERCA 1a) . (Received 27 May 2002, revised 23 A ugust...
  • 13
  • 514
  • 0
Báo cáo hóa học: " Optimization of capsid-incorporated antigens for a novel adenovirus vaccine approach" doc

Báo cáo hóa học: " Optimization of capsid-incorporated antigens for a novel adenovirus vaccine approach" doc

Ngày tải lên : 20/06/2014, 01:20
... NSNAAAAAMQPVEDMNDHAIRGD TFATRAEEKRAEAEAAAEAA 53RGD motif- SGAEENSNAAAAAMQPVEDMNDHAIRGD TFATRAEEKRAEAEAAAEAAAPAAQ 63RGD motif- SNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGD TFATRAEEKRAEAEAAAEAAAPAAQPEVEK 73RGD motif- GGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGD TFATRAEEKRAEAEAAAEAAAPAAQ PEVEKPQKKP 83RGD ... GGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGD TFATRAEEKRAEAEAAAEAAAPAAQ PEVEKPQKKP 83RGD motif- TEQGGGGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGD TFATRAEEKRAEAEAAAEAA APAAQPEVEKPQKKPVIKPL Core Arg-Gly-Asp (RGD) ... CGGGATCCGCCGCGGCAATGCAGCC 43RGD -(as) CGGGATCCGGCAGCTTCGGCCGCTG 43RGD - (a) CGGGATCCAACTCCAACGCGGCAGCC 53RGD -(as) CGGGATCCTTGCGCAGCGGGGGC 53RGD - (a) CGGGATCCAGCGGCGCGGAAGAGAACTC 63RGD -(as) CGGGATCCCTTCTCGACCTCGGGTTGCG 63RGD...
  • 13
  • 419
  • 0
Báo cáo hóa học: " The equiconvergence of the eigenfunction expansion for a singular version of onedimensional Schrodinger operator with explosive factor" pptx

Báo cáo hóa học: " The equiconvergence of the eigenfunction expansion for a singular version of onedimensional Schrodinger operator with explosive factor" pptx

Ngày tải lên : 20/06/2014, 22:20
... research center of Alexandria University. Author details 1 Department of Mathematics, Faculty of Education, Alexandria University, Alexandria, Egypt 2 Faculty of Industrial Education, Helwan University, ... AH Nasser 2 * Correspondence: zaki55@Alex-sci. edu.eg 1 Department of Mathematics, Faculty of Education, Alexandria University, Alexandria, Egypt Full list of author information is available at ... of 11 RESEARCH Open Access The equiconvergence of the eigenfunction expansion for a singular version of one- dimensional Schrodinger operator with explosive factor Zaki FA El-Raheem 1* and AH...
  • 11
  • 260
  • 0
Báo cáo hóa học: " The equiconvergence of the eigenfunction expansion for a singular version of onedimensional Schrodinger operator with explosive factor" potx

Báo cáo hóa học: " The equiconvergence of the eigenfunction expansion for a singular version of onedimensional Schrodinger operator with explosive factor" potx

Ngày tải lên : 20/06/2014, 22:20
... Education, Alexandria University, Alexandria, Egypt Full list of author information is available at the end of the article Abstract This paper is devoted to prove the equiconvergence formula of the ... version of one- dimensional Schrodinger operator with explosive factor Zaki FA El-Raheem 1* and AH Nasser 2 * Correspondence: zaki55@Alex-sci. edu.eg 1 Department of Mathematics, Faculty of Education, ... Faculty of Education, Alexandria University, Alexandria, Egypt 2 Faculty of Industrial Education, Helwan University, Cairo, Egypt Authors’ contributions The two authors typed read and approved...
  • 11
  • 268
  • 0
Báo cáo hóa học: " Research Article Some Subclasses of Meromorphic Functions Associated with a Family of Integral Operators" pptx

Báo cáo hóa học: " Research Article Some Subclasses of Meromorphic Functions Associated with a Family of Integral Operators" pptx

Ngày tải lên : 22/06/2014, 02:20
... Journal of Mathematical Analysis and Applications, vol. 3, no. 1, article 8, 11 pages, 2006. 25 T. N. Shanmugam, S. Sivasubramanian, B. A. Frasin, and S. Kavitha, “On sandwich theorems for certain ... Nishiwaki, S. Owa, and H. M. Srivastava, “Subordination and superordination for multivalent functions associated with a class of fractional differintegral operators,” Integral Transforms and Special ... relationships and integral-preserving properties of certain subclasses of meromorphic functions associated with a family of integral operators,” Journal of Mathematical Analysis and Applications,...
  • 18
  • 308
  • 0
Báo cáo hóa học: " Research Article A Refinement of Jensen’s Inequality for a Class of Increasing and Concave Functions" pptx

Báo cáo hóa học: " Research Article A Refinement of Jensen’s Inequality for a Class of Increasing and Concave Functions" pptx

Ngày tải lên : 22/06/2014, 03:20
... 2008, Article ID 717614, 14 pages doi:10.1155/2008/717614 Research Article A Refinement of Jensen’s Inequality for a Class of Increasing and Concave Functions Ye Xia Department of Computer and Information ... chosen 1 and 2 . These results can be viewed as a refinement of the Jensen’s inequality for the class of functions specified above. Or they can be viewed as a generalization of a refined arithmetic mean-geometric ... Partial Orderings, and Statistical Applications, vol. 187 of Mathematics in Science and Engineering, Academic Press, Boston, Mass, USA, 1992. 3 J B. Hiriart-Urruty and C. Lemar ´ echal, Convex Analysis...
  • 14
  • 373
  • 0