parasuraman a v a zeithaml amp l l berry 1988 servqual a multiple item scale for measuring consumer perceptions of service quality journal of reatailing
A multiple-item scale for measuring customer loyalty development
Ngày tải lên :
24/09/2016, 18:04
... Englewood Cliffs, NJ Parasuraman, A. , Zeithaml, A and Berry, L. L (1988) , SERVQUAL: a multiple- item scale for measuring consumer perceptions of service quality , Journal of Retailing, Vol 64 No ... (1987) scale “Purchasing Involvement”, had a Cronbach’s alpha of 0.86 Therefore, the loyalty scale has a comparable level of reliability at the upper limit in relation to the aforementioned scales ... 475 A multiple- item scale for measuring customer loyalty development Journal of Services Marketing Rosalind McMullan Volume 19 · Number · 2005 · 470 –481 Figure Loyalty scale items loading on factors...
- 12
- 548
- 0
Consumer perceived value The development of a multiple item scale
Ngày tải lên :
24/09/2016, 18:06
... 285–304 Dabholkar, Pratibha A. , Dayle I Thorpe and Joseph O Rentz (1996) A Measure of Service Quality for Retail Stores: Scale Development and Validation,” Journal of the Academy of Marketing ... Soutar / Journal of Retailing 77 (2001) 203–220 TABLE Summary of Final Results from Exploratory Factor Analysis—Stage Two Item Quality Emotional Price has consistent quality is well made has an acceptable ... The reliabilities range from 0.84 to 0.95 This represents an improvement in the reliability of scales for quality, price and social value, although the emotional value scale was slightly less...
- 18
- 547
- 0
a new measurement scale for employee engagement
Ngày tải lên :
07/09/2013, 11:05
... personality trait that is generalizable acrosssituations Rather, it is a relatively stable psychologicalstate In terms of temporalstability (i.e, malleability), variance in individual levels of ... identifiesthe state of employee engagement REFERENCES AVAILABLE FROM THE AUTHORTable Final 9 -item Employee Engagement Scale I am willing to really push myself to reach challenging work goals I am prepared ... rate was 58% The replication data furthersupported the findingsfrom the pilot-testsample To begin, the engagementscale generated an alpha value of. 89 This value isslightly lower than the alpha...
- 7
- 378
- 1
A novel interval method for validating state enclosures of the
Ngày tải lên :
12/01/2014, 22:04
... mean-value rule evaluation and other advanced interval methods such as monotonicity tests and iterative techniques for range calculation In contrast to the VAL E NC IA-IVP solver, VNODE is based ... intervals in Step Overestimation due to multiple occurrence of identical interval variables in (7) is reduced by mean-value rule evaluation as well as efficiently implemented iterative improvement ... sensitivity and reliability 12 analysis as well as robust and optimal controller design [23] are interesting topics for future research Additionally, validated solutions of initial value problems...
- 12
- 373
- 0
Tài liệu Báo cáo khoa học: "Collecting a Why-question corpus for development and evaluation of an automatic QA-system" pdf
Ngày tải lên :
20/02/2014, 09:20
... which are not asked, and also contain practical examples Human-powered answers often contain unrelated information and discourselike elements Additionally, the answers not always have a connection ... ROUGE-metric: calculating the N-gram overlap between manual, “correct” summaries, and the automatic summaries ROUGE has been proven to correlate well with human evaluation (Lin and Hovy, 2003) Overlaps of ... and Application of Large -scale Knowledge Resources (COE-LKR)” References Yllias Chali and Maheedhar Kolla 2004 Summarization Techniques at DUC 2004 In DUC2004 Hoa Trang Dang, Diane Kelly, and...
- 9
- 610
- 1
Báo cáo khoa học: MR solution structure of the precursor for carnobacteriocin B2, an antimicrobial peptide fromCarnobacterium piscicola Implications of the a-helical leader section for export and inhibition of type IIa bacteriocin activity pdf
Ngày tải lên :
07/03/2014, 15:20
... AISYGNGVYCNKEKCWVNKAENKQAITGIVIGGWASSLAGMGH MMNMKPTESYEQLDNSALEQVVGG MKKIEKLTEKEMANIIGG KYYGNGVHCTKSGCSVNWGEAFSAGVHRLANGGNGFW KYYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATGGHQGNHKC MTNMKSVEAYQQLDNQNLKKVVGG KYYGNGVHCTKSGCSVNWGEAASAGIHRLANGGNGFW ... MMKKIEKLTEKEMANIIGG KYYGNGVSCNSHGCSVNWGQAWTCGVNHLANGGHGVC KYYGNGVTCGKHSCSVNWGQAFSCSVSHLANFGHGKC MKTVKELSVKEMQLTTGG MKSVKELNKKEMQQINGG KYYGNGVSCNKNGCTVDWSKAIGIIGNNAAANLTTGGAAGWNKG AISYGNGVYCNKEKCWVNKAENKQAITGIVIGGWASSLAGMGH ... is easy, but large -scale proteolytic cleavage of the MBP portion by Factor Xa also results in removal of two C-terminal amino acids of preCbnB2, namely Arg65 and Pro66, to yield the truncated...
- 9
- 519
- 0
Báo cáo khoa học: A new molecular tool for transgenic diatoms Control of mRNA and protein biosynthesis by an inducible promoter–terminator cassette docx
Ngày tải lên :
07/03/2014, 21:20
... role of diatom proteins in short-lived cellular processes such as cytokinesis and valve and girdle band formation which are completed in less than h In future, analysis of cell division or valve ... (GenBank accession number X52869) was amplified from pZEOSV (Invitrogen, Carlsbad, CA, USA) by PCR using sense primer 5¢-ATCAAAACAACCAAAA TGGCCAAGTTGACCAGTGC-3¢ and antisense primer 5¢-GAATGCGGCCGCTCAGTCCTGCTCCTCGGCCAC-3¢, ... (developed in rabbit; Clontech, Mountain View, CA, USA) was used and an antirabbit IgG–alkaline phosphatase conjugate (Sigma) as the secondary antibody Microscopy analysis Confocal imaging was...
- 11
- 668
- 0
Báo cáo khoa học: "A Word-Order Database for Testing Computational Models of Language Acquisition" docx
Ngày tải lên :
08/03/2014, 04:22
... endeavor, we have developed the Language Domain Database – a publicly available test-bed for studying acquisition models from diverse paradigms Mathematical analysis has shown that learners are ... "O3[+WH]" )"Adv[+NULL][SLASH Adv]")))))))) To be readable, the derivations are displayed graphically as tree structures Towards this end we have utilized a set of publicly available LaTex macros: ... Feasibility As a simple example of a learning strategy and of our simulation approach, consider a domain of binary parameters and a memoryless learner which blindly guesses how all parameters should be...
- 8
- 368
- 0
Reproductive System Structure, Development and Function in Cephalopods with a New General Scale for Maturity Stages pot
Ngày tải lên :
14/03/2014, 16:20
... phase AG are completely formed and usually white Gonad is large, usually dullwhite Spermatozoa accumulate in testis ampullae SG completely formed, usually white III Gonad maturation, AG final formation ... also gratefully acknowledge B G Ivanov, K N Nesis, Va I Starobogatov, Yu A Filippova, Yu M Froerman and F E Alexeev for their valuable comments and A S Schetinnikov, R M Sabirov and especially ... episodes of nucleoli appearance and disappearance Nucleoli are not distinguishable before simple follicle formation in Octopoteuthis sicula, Sepia bertheloti and Abraliopsis atlantica In Argonauta argo...
- 12
- 623
- 0
Đề tài " A C1-generic dichotomy for diffeomorphisms: Weak forms of hyperbolicity or infinitely many sinks or sources " ppt
Ngày tải lên :
28/03/2014, 22:20
... diffeomorphisms of compact surfaces are either Anosov or have Lyapunov exponents equal to zero for almost every orbit (see ne also [Ma4] for an outline of a possible proof).5 Ma˜´ also announced a version of ... an arbitrarily small perturbation) to get M having only eigenvalues (complex or real) with multiplicity one and such that any pair of eigenvalues with the same modulus are complex and conjugate, ... eigenvalues have modulus bigger than 1) or a contraction (i.e all its eigenvalues have modulus less than 1) ˜ Then there are a dense f -invariant subset Σ of Σ and an ε-perturbation ˆ ˜ A of A such...
- 65
- 350
- 0
A gene expression database for the molecular pharmacology of cancer pptx
Ngày tải lên :
30/03/2014, 13:20
... pharmacologically interesting behaviours are not always reflected at the transcriptional level It will be necessary to assess differences among cells at the DNA and protein levels as well An overall aim of ... positive or negative correlation between a cluster of genes and a cluster of drugs The data and a full-resolution version of the figure are available (http://discover.nci.nih.gov) Examples of causally ... DC, 1993) Paull, K.D et al Display and analysis of patterns of differential activity of drugs against human tumor cell lines: development of mean graph and COMPARE algorithm J Natl Cancer Inst...
- 9
- 484
- 0
báo cáo hóa học: " Psychometric properties of a single-item scale to assess sleep quality among individuals with fibromyalgia" potx
Ngày tải lên :
18/06/2014, 18:20
... more adequate sleep Statistical methods Test re-test reliability and convergent validity analyses of the Sleep Quality Scale were obtained from all available study patients across all treatment ... medication up to and including Day1 If fewer than scores are available then baseline consists of all scores that are available Page of (page number not for citation purposes) Health and Quality of ... McGrawHill; 1994 Cohen J: Statistical Analysis for the Behavioral Sciences Second edition Hillsdale, NJ: Lawrence Erlbaum Associates; 1988 Abad V, Sarinas P, Guilleminault C: Sleep and rheumatologic...
- 7
- 597
- 0
báo cáo hóa học: " A radial basis classifier for the automatic detection of aspiration in children with dysphagia" doc
Ngày tải lên :
19/06/2014, 10:20
... signal as an aspiration when a swallow has actually occurred, whereas a false negative (FN) is the event of classifying a vibration signal as a swallow when an aspiration has actually occurred Likewise ... Figure Sample swallow signals on the left and aspiration signals on the right Sample swallow signals on the left and aspiration signals on the right Note that swallows are typically longer in duration ... Reliability and validity of cervical auscultation: a controlled comparison using videofluoroscopy Dysphagia 2004, 19(4):231-240 Reddy N, Katakam A, Gupta V, Unnikrishnan R, Narayanan J, Canilang...
- 17
- 497
- 0
báo cáo hóa học:" Psychometric evaluation of a visual analog scale for the assessment of anxiety" pdf
Ngày tải lên :
20/06/2014, 16:20
... healthrelated quality -of- life: the remarkable universality of half a standard deviation Med Care 2003, 41:582-592 38 Scrimshaw SV, Maher C: Responsiveness of visual analogue and McGill pain scale ... van Lanschot JJB, Stalmeier PFM, van Sandick JW, Hulscher JBF, de Haes JCJM, Sprangers MAG: Is a single -item visual analogue scale as valid, reliable and responsive as multi -item scales in measuring ... HA: Reproducibility along a 10 cm vertical visual analogue scale Ann Rheum Dis 1981, 40(1):87-89 12 Guyatt GH, Townsend M, Berman LB, Keller JL: A comparison of Likert and visual analogue scales...
- 8
- 385
- 0
báo cáo hóa học: " A game-theoretic architecture for visible watermarking system of ACOCOA (adaptive content and contrast aware) technique" pdf
Ngày tải lên :
21/06/2014, 00:20
... 512 images The image quality metrics for the payoff function are available at the following website: MeTriX MuX Visual Quality Assessment Package [31] The grayscale watermark of logo image adopted ... are also performed and we can see similar results for visual image quality measure values and visual comparison 4.2 Median filter Applying the same approaches under proposed gametheoretical architecture, ... range of [1] where a higher P value means that host image has stronger watermark embedded Table shows Al,θ for a 5-level 9/7 DWT from [12] Table shows Gl,θ values after a 5-level wavelet pyramidal...
- 22
- 393
- 0
báo cáo hóa học:" Research Article Strong Convergence of a New Iterative Method for Infinite Family of Generalized Equilibrium and Fixed-Point Problems of Nonexpansive Mappings in Hilbert Spaces" pptx
Ngày tải lên :
21/06/2014, 11:20
... 2008 S Takahashi and W Takahashi, “Viscosity approximation methods for equilibrium problems and fixed point problems in Hilbert spaces,” Journal of Mathematical Analysis and Applications, vol 331, ... Analysis and Applications, vol 298, no 1, pp 279–291, 2004 G Marino and H.-K Xu, A general iterative method for nonexpansive mappings in Hilbert spaces,” Journal of Mathematical Analysis and Applications, ... 2007 S Plubtieng and R Punpaeng, A general iterative method for equilibrium problems and fixed point problems in Hilbert spaces,” Journal of Mathematical Analysis and Applications, vol 336, no...
- 24
- 398
- 0
Báo cáo hóa học: "Research Article A Rules-Based Approach for Configuring Chains of Classifiers in Real-Time Stream Mining Systems Brian Foo and Mihaela van der Schaar" pot
Ngày tải lên :
21/06/2014, 19:20
... large/distributed rule space provided the best performance as well as the lowest average delay and delay variance As indicated by Table 4, each classifier converges toward a different local rule ... a large state space with levels of utility as well as levels of local utilities for each classifier, totaling 32 states Due to the high complexity and long convergence time of the centralized approach, ... second approach (Small Rule Space) uses a state space consisting of the different levels of minimum utility and a centralized algorithm that allocates identically to each and every classifier, one of...
- 17
- 416
- 0
Báo cáo hóa học: "Research Article A Viscosity Approximation Method for Finding Common Solutions of Variational Inclusions" pptx
Ngày tải lên :
21/06/2014, 20:20
... “Perturbed algorithms and sensitivity analysis for a general class of variational inclusions,” Journal of Mathematical Analysis and Applications, vol 201, no 2, pp 609–630, 1996 J.-W Peng, Y Wang, ... Theory and Applications S Plubtieng and R Punpaeng, A general iterative method for equilibrium problems and fixed point problems in Hilbert spaces,” Journal of Mathematical Analysis and Applications, ... Theory and Applications map The classical variational inequality which is denoted by V I A, C is to find u ∈ C such that Au, v − u ≥ 0, v ∈ C 1.2 The variational inequality has been extensively studied...
- 20
- 336
- 0
Báo cáo hóa học: " Research Article A Two-Stage Approach for Improving the Convergence of Least-Mean-Square Adaptive Decision-Feedback Equalizers in the Presence of Severe " doc
Ngày tải lên :
22/06/2014, 19:20
... constants and learning curves of LMS adaptive filters,” Tech Rep 312, Naval Ocean Systems Center, San Diego, Calif, USA, 1978 [24] M J Shensa, “The spectral dynamics of evolving LMS adaptive filters,” ... implies that if the data fed back is perfect, the ISI caused Arun Batra et al by the M previous data symbols will be completely canceled Also note that (13) is a scaled (by 1/(1 + SNR)) multiple ... algorithms available, we focus on a low-complexity method, specifically the leastmean square (LMS) algorithm [11] The LMS algorithm is also noted for its robustness and improved tracking performance...
- 13
- 365
- 0
Báo cáo hóa học: "A Hybrid Resynthesis Model for Hammer-String Interaction of Piano Tones" ppt
Ngày tải lên :
23/06/2014, 01:20
... mistakes on the amplitudes of the loop filters (for instance, a very small value of the modulus of one loop filter may be compensated by a value greater than one for another loop filter; the stability ... perceptual effect produced by the instrument The hybrid model provides a perceptually plausible resynthesis of a sound as well as intimate manipulations in a physically and perceptually relevant way ... centroid and the energy for several notes The curves have similar behavior and differ mainly by a multiplicative constant We have fitted their asymptotic behavior by an exponential model, similarly to...
- 15
- 189
- 0