... examples are the point explosion and implosion problems (Taylor (1950), Sedov (1959), Guderley (1942)) Simple scaling arguments to obtain similarity solutions, illustrating also the self-similar ... the balancing argument for nonlinear PDEs to find approximate solutions of nonlinear problems The concluding chapter expounds series solutions for nonlinear PDEs with the help of several examples; ... Surface Flows for Shallow-Water Equations 3.8 An Example from Gasdynamics Exact Travelling Wave Solutions 4.1 Travelling Wave Solutions 4.2 Simple Waves in 1-D Gasdynamics 4.3 Elementary Nonlinear...
Ngày tải lên: 24/04/2014, 17:09
Ngày tải lên: 24/04/2014, 17:21
Chính sách mới về Giáo dục, dịch vụ pháp lý và thể thao
... VnDoc.com - Tải tài liệu, v n ph p luật, biểu mẫu miễn phí Từ ngày 01/8/2015, Thông tư 03/2015/TT-BVHTTDL quy định giám định khoa học đánh giá trình độ t p luyện thể thao kiểm tra sức khỏe v n ... hoạch huấn luyện Kiểm tra sức khỏe bổ sung thực việc tuyển chọn v n động viên mới, v n động viên bắt đầu t p luyện sau thời gian điều trị chấn thương, chuyển tuyến đào tạo trường h p sở đào tạo, ... thao kiểm tra sức khỏe v n động viên bắt đầu có hiệu l c thi hành Theo đó, v n động viên kiểm tra sức khỏe theo nội dung ghi Giấy khám sức khỏe quy định Phụ l c Phụ l c ban hành kèm theo Thông tư...
Ngày tải lên: 09/12/2015, 05:07
Vừng đen - vị thuốc quý giúp làn da đẹp và tóc lâu bạc
... ong v a đủ Tán bột l m viên, ngày uống 10-20 viên, dùng dạng thuốc sắc liều thích h p Bài 2: V ng đen, đại táo, xuyên khung, đương quy, bá tử nhân, v 8g Thục địa, bạch thược v 12g Tất cho v o ... - Chữa viêm mũi mạn tính: L y dầu v ng đem đun sôi, giữ nhỏ l a cho sôi nhẹ 15 phút Khi nguội, đổ dầu v o l có nút kín, dùng dần Ngày nhỏ mũi l n: đầu nhỏ 2-3 giọt, quen tăng l n 4-5 giọt ... mạnh 2-3 phút cho dầu lan ngấm kỹ v o niêm mạc mũi Dùng sau tuần khỏi bệnh - Chữa chân tay đau buốt thũng: Đây chứng th p nhiệt thâm nhiễm l m chân tay đau buốt thũng Cách chữa: l y 40g hạt v ng...
Ngày tải lên: 24/12/2015, 01:07
Bơm ECD-V - P -ECD-V Series
... spill valve Pilot Valve Coil Spill Passage Main Valve Fuel Return Plunger Conventional Type PR0080 Direct-Acting Type Valve Spill Passage Fuel Return (to pump chamber) Pressure Chamber Plunger Direct-Acting ... type)] Construction A direct-acting type solenoid valve is used in order to achieve high levels of response and spill performance Valve Body Core Coil Spool Valve Valve Body Spring Coil Spool Valve ... of the fuel Thermistor PR0078 - 23 - (8) Solenoid Spill Valve (SPV) The solenoid spill valve directly controls the injection volume It is a pilot type solenoid valve that provides high pressure...
Ngày tải lên: 23/10/2012, 09:09
P L L
... Hội trường Phòng GD huyện Nam Đông Để tham dự h p công tác phổ c p GDPT GIẤY MỜI DỰ L PHÁT THƯỞNG HỌC SINH V GIÁO VIÊN TIÊU BIỂU NĂM HỌC: 2005-2006 Nhận giấy mời, kính mong quý v x p thời gian ... UBND huyện V o l c: 8h00 ngày 19 tháng 11 năm 2007 Để dự phát biểu chúc mừng Sự diện quý v đại biểu niềm cổ v , động viên khích l cho cán giáo viên toàn ngành Rất hân hạnh đón ti p quý v đại biểu ... ĐẠO CMC-PCGD PHÒNG GIÁO DỤC Độc l p - Tự - Hạnh phúc Nam Đông, ngày14 tháng 11 nă GIẤY MỜI CỘNG HÒA XÃ HỘI CHỦ NGHĨA VIỆT Số…./GM 2005 Nam Đông, ngày … tháng 12 năm Độc L p- Tự Do-Hạnh Phúc ………………………………………...
Ngày tải lên: 17/10/2013, 01:11
Ảnh hưởng của dịch tảo chlorella vulgaris lên một số chỉ tiêu sinh trưởng của hai giống lạc sen nghệ an và l v t ở phòng thí nghiệm
... Đông(1984) l c có thành phần dinh dỡng:{5} V l c: 80 -> 90 % Gluxit -> 7% -> 3% V l a: Prôtêin Lipit 18% Xenluloz 13% Prôtêin 1% 2% L mầm: Lipit Khoáng 50% Lipit 30% Prôtêin - Theo tác giả L Doãn ... Tình hàm l ng di p l c ( mg di p l c/g nguyên liệu ) : A= CV P. 1000 Tính hàm l ng di p l c a : A( a ) = C V a P. 1000 (mg/g) Tính hàm l ng di p l c b: 19 Luận v n tốt nghi p cử nhân s phạm A( b ... điều có hàm l ng di p l c a, di p l c b di p l c ( a + b) cao l đối chứng Cao l C giống Sen NA l C giống L. V. T Dịch tảo Chlorella l m tăng cờng độ hô h p giống l c trên, tất l đợc xử l dịch...
Ngày tải lên: 18/12/2013, 10:17
Tài liệu Báo cáo khoa học: L-Arabinose transport and catabolism in yeast doc
... XYLITOL LAD XI NAD NADH NAD NADH LXR NADP XDH NADPH L- XYLULOSE D-XYLULOSE L- RIBULOSE XK ADP D-XYLULOSE ATP ATP RK ATP XK ADP ADP RPE D-XYLULOSE- 5P L- RIBULOSE- 5P D-XYLULOSE- 5P PPP PPP Bacteria Filamentous ... d-xylose and l- arabinose metabolism are intrinsically related All enzymes required to convert d-xylose into d-xylulose, which is then phosphorylated to d-xylulose 5-phosphate which enters the phosphate ... °C in a Sorvall SLA-1500 rotor and washed twice with ice-cold demineralized water Pelleted cells, 0.6 g wet mass, were collected in a 2-mL Eppendorf tube, and 1.5 mL Y-PERÒ Yeast Protein Extraction...
Ngày tải lên: 19/02/2014, 00:20
Báo cáo khoa học: "Aligning Articles in T V Newscasts and Newspapers" pdf
... respectively, length(k) is the length of the word k Experimental Results To evaluate our approach, we aligned articles in the following TV newscasts and newspapers: • NHK evening TV newscast, and • ... Kyoto University, (1997) * Mino: Intelligent Retrieval for Video Media (in Japanese), Journal of Japan Society for Artificial Intelligence Vol.ll No .l, (1996) 1The source file and the explanation ... articles (Asahi Newspaper; April, 4, 1996) 3.1 Aligning Articles in TV Newscasts and Newspapers Extracting Nouns from Telops An article in the T V newscast generally shares many words, especially...
Ngày tải lên: 17/03/2014, 07:20
Neurodegeneration Edited by L. Miguel Martins and Samantha H.Y. Loh pot
... neurotransmitter and neuromodulator (Chronwall et al., 1985; Gray & Morley, 1986) It belongs to the pancreatic polypeptide family (PP family) together with peptide YY (PYY) and pancreatic polypeptide (PP), ... Fig The level of alpha-tubulin acetylation in the molecular layer of the cerebellum from wild-type (WT) and WldS mice during postnatal development Details of the procedures are previously described ... the level of acetylated alphatubulin per total alpha-tubulin is significantly higher in the WldS cerebellum compared to the wild-type cerebellum at postnatal 21 days (P2 1) Fig Acetylation and...
Ngày tải lên: 23/03/2014, 15:20
Asthma WellnessKeeping Children with Asthma in School and Learning Liability & Litigation: A Legal Primer Asthma & Indoor Air Quality (IAQ)Asthma Management, Policies and Procedures.St r a i g h tBy Paul D. Houstont a l kIn School and Healthy: docx
... National Asthma Education and Prevention Program (NAEPP) suggests that school districts develop and implement districtwide guidelines and protocols applicable to chronic illnesses generally and specific ... Valley Syndrome “This is a glorious place to live,” says Supt William Dean, “but there are lots of oaks and maples and pines that give off allergens We also have the agribusinesses, especially ... IDEA and “504” outline student evaluation procedures and stipulate the creation of individual health plans—an Individualized Education Plan (IEP) and a “504” accommodation plan, respectively In...
Ngày tải lên: 23/03/2014, 23:20
OMB Report Pursuant to the Sequestration Transparency Act of 2012 (P. L. 112–155) potx
... a rate of operations as provided in the applicable appropriation act for FY 2012, plus any funding enacted as advance appropriations for FY 2013 The annualized level, which is a preliminary estimate, ... and migrant health centers (which applies only to the mandatory funding of those programs), and a special rule for applying the sequestration to student loans The calculation involves the following ... exempt military personnel accounts from sequestration, available at: http://www.whitehouse.gov/sites/default/files/omb/leg islative/letters/military-personnel-letter-biden.pdf OMB REPORT PURSUANT...
Ngày tải lên: 23/03/2014, 23:21
Báo cáo khoa học: Characterization of L-aspartate oxidase and quinolinate synthase from Bacillus subtilis potx
... -EETIVFCGVHFMAETAKILSPNK-MTVLNRTDTLVDELT -ADITNTPLGYGGVDGDERWAAEIRRLAHLRGATVLAHNYQLPAIQDVADHVG -DSLALSRVAAEAP -EDTIVFCGVHFMAETAKILSPHK-VPSFEPFPSLVLTAHGIEAKGSFAQAQAKYLFPEESRVEELVNVLKEKKIGVVAHFYMDPEVQGVLTAAQKHWPHISISDSLVMADSAVTMAKAGCQFITVLGVDFMSENVRAILDQAGF ... -EVHVDPGIAASGRRSVQ G SSANSKLKVEVVFPVSSDSMTKTSSDSSNSIKVGDVA LPVVPGVAGGEGCSIHGGCASCPYMKMNSLSSLLKVCHKLPDLENVYGGFIAERFKRQTPQGKLIADVGCEPIL DSYKTSQQSANIEVEIVFPVSSDAVSNTSVNGSHHLDSSTVTDLDNVSVVPGVSSGEGCSIHGGCASCPYMKMNSLRSLLKVCHQLPDRDNRLVAYQASRFNAKTPLGKLVAEVGCEPIL ... TVLIPD-QRAGCSLADSITPDELRAWKDEHPGAV -VVSYVNTTAAVKALTD -ICCTSSNAVDVVAS -IDPDREVLFCPDQFLGAHVRRVTGRK -EKVGVYRMSDETIGCSLADAASAPAYLNYLEAASRSPPS LHVVYINTSLETKAFAHELVPTITCTSSNVVQTILQAFAQMPELTVWYGPDSYMGANIVKLFQQMTLMTNEEIANIHPK...
Ngày tải lên: 30/03/2014, 02:20
Báo cáo khoa học: DNA-binding and transcription characteristics of three cloned sigma factors from mustard (Sinapis alba L.) suggest overlapping and distinct roles in plastid gene expression doc
... chloroplast counterparts Plant Mol Biol 21, 503–513 13 Tiller, K & Link, G (1993) Phosphorylation and dephosphorylation affect functional characteristics of chloroplast and etioplast transcription ... chloroplast transit peptides (for review see [31]) and this region was tentatively identified as a transit peptide by several localization prediction programs The predominant chloroplast localization ... Two plastid RNA polymerases of higher plants: an evolving story Trends Plant Sci 3, 4–6 Link, G (1994) Plastid differentiation: organelle promoters and transcription factors In Plant Promoters and...
Ngày tải lên: 31/03/2014, 07:20
helbig a., buranbaeva o., mladineo v. culture and customs of ukraine. westport - london, 2009
... Chernihiv, Chernivtsi, Dnipropetrovsk, Donetsk, Ivano-Frankivsk, Kharkiv, Kherson, Khmelnytsk, Kirovohrad, Kyiv, Luhansk, L viv, Mykolaiv, Odesa, Poltava, Rivne, Sumy, Ternopil, Vinnitsya, Volhynia, ... a few million people less in Ukraine than in New York State and California combined The average population density is approximately 205 people per square mile (80 people per square kilometer), ... either Polonized or Russified, the village and village life came to represent all things Ukrainian in nationalist movements, literature, and folklore This has changed drastically over the last half-century,...
Ngày tải lên: 04/06/2014, 17:42
báo cáo hóa học:" Identification of a public CDR3 motif and a biased utilization of T-cell receptor V beta and J beta chains in HLA-A2/Melan-A-specific T-cell clonotypes of melanoma patients" potx
... pre/post TIL/PBL Melan-A* 6, 28 17 post PBL CD8-sorted cells T-cell clones Melan-A* no 18 T-cell clones Melan-A* no T-cell clones CD8-sorted cells Melan-A* Melan-A* no no 19 pre TIL PBL/TIL TIL pre/post ... Translational Medicine 2009, 7:21 42 T-cell lines CTL/CD8sorted population CTL/CD8sorted cells T-cell clones 939 CD8-sorted cells T-cell culture M57-68 (flu) GL9 (EBV) no no NV9 (CMV) pp65 (NLV/A2, HCMV) ... DNP-modified melanoma cells - no TIL A2 no TIL, PBL, normal skin PBL - Melan-A/ gp100 - - - 27, 9, 20, 29, 28, TIL - - 28, 2, 24 32 PBL T-cell clones MAGE1 no 33 PBL/TIL T-cell clones, PBL-PHA...
Ngày tải lên: 18/06/2014, 15:20
báo cáo hóa học:" Is there a relationship between factor V Leiden and type 2 diabetes?" doc
... study; PF and IQ performed all laboratory tests; PDM and LL performed scientific up-date; CL and LLR perfomed study design and statistical analysis All authors read and approved the final manuscript ... than 199 mg/dl Table 1: Glycaemic parameters in subjects with VTE and with or without FVL Parameters Patients with VTE and FVL Patients with VTE without FVL p Glycaemia at baseline (mg\dl) 93.55 ... develop more vascular complications both as atherothrombosis (of any district) as VTE and other patients with diabetes not develop vascular complication In previous years several research suspected...
Ngày tải lên: 18/06/2014, 15:20
Báo cáo toán học: " Nonexistence of nontrivial solutions for the p(x)-Laplacian equations and systems in unbounded domains of Rn" docx
... nontrivial solutions of the semilinear elliptic equations and systems, under various situations, see [1-8] The Pohoza v identity e [1] published in 1965 for solutions of the Dirichlet problem proved ... ∈ ∂Ω So, the problem admit only the null solution Proof Similar to the that of theorem Examples 1 ,p( x) Example Considering in W0 1,q (Ω) ∩ W0 Ω the following problem p( x)−2 − div | u| u = on ... ∂sk H is previously defined and pk functions of C Ω class, verify pk (x) > 1, (x, ak = sup − x∈Ω pk (x)) ≥ 0, ∀x ∈ Ω n pk (x) + (1.9) (x, pk (x)) p2 (x) k Integral identities Let Lp(x) (Ω) =...
Ngày tải lên: 20/06/2014, 21:20
Báo cáo hóa học: " Research Article Three Solutions for a Discrete Nonlinear Neumann Problem Involving the p-Laplacian Pasquale Candito1 and Giuseppina D’Agu`2 ı" pptx
... solutions,” Journal of Difference Equations and Applications In press 13 P Candito and N Giovannelli, “Multiple solutions for a discrete boundary value problem involving the p- Laplacian,” Computers & Mathematics ... with lower and upper solutions,” Nonlinear Analysis: Theory, Methods & Applications, vol 67, no 4, pp 1236–1245, 2007 R P Agarwal, K Perera, and D O’Regan, “Multiple positive solutions of singular ... Equations, vol 2008, Article ID 345916, 10 pages, 2008 12 A Krist´ ly, M Mihailescu, and V Radulescu, “Discrete boundary value problems involving e oscillatory nonlinearities: small and large solutions,”...
Ngày tải lên: 21/06/2014, 07:20
Bạn có muốn tìm thêm với từ khóa: