nrf2 mafk binds to the gpe1 element of gst p gene
Báo cáo khoa học: A new rice zinc-finger protein binds to the O2S box of the a-amylase gene promoter pptx
Ngày tải lên :
16/03/2014, 18:20
... random protein databases revealed that there is no significant homology between DGSSSSA AREVSWVPDPVTGHYRPSNFAGGRRRRPPRRPPRP DTRDGSK AYSTDWAPDPVTGYYRPINHTPEIDPVELRHRLLR KWEESS -KKTTSWVPDPVTGYYRPESHAKEIDAAELRQMLLN ... fusion protein 25 bound to the cis -element in bait pLGD-265UP1, and induced transcription of the LacZ reporter gene To examine whether RAMY protein binds to the O2S sequence directly and specifically, ... and purified To determine whether the expression of the RAMY gene is by affinity chromatography (B) Gel mobility assay with the purified induced by GA, and the possible relationship between the GST RAMY...
- 7
- 359
- 0
Báo cáo khoa học: Sp1 binds to the external promoter of the p73 gene and induces the expression of TAp73c in lung cancer doc
Ngày tải lên :
29/03/2014, 09:20
... the same gene is thought to generate products with opposing roles, mainly the apoptotic TA isoform(s) and the antiapoptotic DM isoforms In general, TAp73 isoforms regulate the transcription of ... from further analysis Binding of endogenous Sp1 from lung cancer cell lines to the p7 3 P1 promoter In order to validate the ability of endogenous Sp1 to bind to the p7 3 P1 promoter within the cellular ... Sp1 Discussion In the search for transcription factors that affect the use of the p7 3 P1 promoter, we identified a region )233 to )204 bp upstream of the TSS of the human p7 3 P1 promoter containing...
- 14
- 393
- 0
Báo cáo khoa học: A chloroplast RNA binding protein from stromal thylakoid membranes specifically binds to the 5¢ untranslated region of the psbA mRNA potx
Ngày tải lên :
17/03/2014, 11:20
... of psbA gene expression in C reinhardtii This resembles the situation found for the regulation of translation initiation of the psbD gene in chloroplasts of C reinhardtii In the case of the psbD ... Other templates for in vitro synthesis of the different 5¢ UTR RNAs were generated by PCR with the following oligonucleotides: psbA RNA (wild-type sequence of the psbA mRNA corresponding to positions ... cross-linking with the psbD RNA Sedimentation of marker proteins (in kDa) is indicated at the top The arrows point to RBP63, and RBP61 is marked by asterisks Ó FEBS 2002 Protein binding to the psbA 5¢...
- 8
- 338
- 0
Báo cáo khoa học: LIN54 is an essential core subunit of the DREAM / LINC complex that binds to the cdc2 promoter in a sequence-specific manner ppt
Ngày tải lên :
23/03/2014, 04:20
... ng of unlabeled cdc2 promoter fragment was used to compete for the binding of the GST protein to the labeled probe (+) Labeled DNA was detected by autoradiography The positions of the free probe ... binding of E2F4 and p1 30 to the CDE element in G0 [22] Binding of LIN54 to the adjacent CHR element could therefore stabilize the binding of E2F4 ⁄ p1 30 at CDE To address whether the CDECHR element ... of E2F4 and p1 30 to the CDE part of the composite element [22,31] Because LIN54 binds to CHR, interaction of E2F4 ⁄ p1 30 with CDE could be stabilized by binding of LIN54 to the adjacent CHR element...
- 14
- 456
- 0
Báo cáo khoa học: Annexin A2 binds to the localization signal in the 3¢ untranslated region of c-myc mRNA ppt
Ngày tải lên :
30/03/2014, 15:20
... with the cytoskeleton Further studies are in progress to investigate the role of other proteins in the perinuclear localization RNP complex Experimental procedures Subcloning of fragments of the ... mRNPs associated with the cytoskeleton, either in the form of actively translating mRNPs in cytoskeletonbound polysomes or inactive mRNPs [17] Taken together with the ability of annexins to bind ... mechanisms of this spatial organization of the protein synthetic apparatus and mRNA localization by 3¢UTR signals are still poorly understood, particularly the nature of the proteins that bind to these...
- 9
- 232
- 0
Lecture Notes: Introduction to the Finite Element Method
Ngày tải lên :
23/10/2013, 15:46
... (The Procedure) Divide structure into pieces (elements with nodes) Describe the behavior of the physical quantities on each element Connect (assemble) the elements at the nodes to form an approximate ... analyses) COSMOS (General purpose FEA) ALGOR (PC and workstations) PATRAN (Pre/Post Processor) HyperMesh (Pre/Post Processor) Dyna-3D (Crash/impact analysis) A Link to CAE Software and Companies © 1997-2003 ... of each type of elements covered in this course Be able to prepare a suitable FE model for given problems Can interpret and evaluate the quality of the results (know the physics of the problems)...
- 188
- 1.5K
- 5
Tài liệu 77 Introduction to the TMS320 Family of Digital Signal Processors docx
Ngày tải lên :
25/12/2013, 06:16
... the nearest TI field sales of ce for availability Package DIP/PLCC DIP/PLCC DIP/PLCC PLCC CERQUAD CERQUAD PLCC DIP/PLCC/ PQFP DIP/PLCC DIP/CERQUAD DIP/CERQUAD DIP/PLCC DIP/PLCC DIP/PLCC PQFP PQFP ... 25/20e 50/35/ 25/20e Package PQFP PQFP/TQFP PQFP/TQFP PQFP/TQFP PQFP/TQFP PQFP/TQFP PQFP/TQFP a Ser = serial; Par = parallel; DMA = direct memory access concurrent with CPU operation; Int = internal; ... PQFP PGA and PQFP PGA and PQFP PGA and PQFP PGA and PQFP PQFP PQFP PQFP PQFP PQFP PGA PGA a Ser = serial; Par = parallel; DMA = direct memory access concurrent with CPU operation; Int = internal;...
- 37
- 508
- 1
Tài liệu Higher Education in ‘Business Administration’ in Spain: Adapting to the European Area of Higher Education * pptx
Ngày tải lên :
18/02/2014, 11:20
... categories of employment From this information, to determine the relative weights of each of the subjects of the structure in terms of their relevance to the labour market, they requested the opinion of ... knowledge and compulsory subjects, and of course, to the number of total ECTS that, as was previously noted, have to add up to a total of 240 The content of the studies resulting in the award of a degree ... mention that the general aspects of our discussion apply to any of the aforementioned degrees Even though each university has full autonomy to prepare their curricula, the fact that the curricula...
- 9
- 435
- 1
Tài liệu Báo cáo khoa học: Top-down MS, a powerful complement to the high capabilities of proteolysis proteomics pdf
Ngày tải lên :
18/02/2014, 16:20
... MS ⁄ MS will then show the substituent positions of different isomers A problem for MS ⁄ MS of either the peptides for the bottom-up approach or of the proteins for the top-down approach is that ... [9–13] The sample is digested with a protease such as trypsin to produce a mixture of small peptides from each protein, and is applicable to even a complex mixture of proteins (e.g the ‘shotgun approach’) ... sequence of the predicted protein; the cleavage loss of the signal peptide left two more amino acids on the protein than predicted Even if the bottom-up approach did provide mass data on a peptide containing...
- 13
- 572
- 0
Tài liệu Báo cáo khoa học: Evidence for noncooperative metal binding to the a domain of human metallothionein ppt
Ngày tải lên :
19/02/2014, 00:20
... conformation of the protein and the coordination properties of the incoming metal ions Metallation of apo-a-rhMT-1a with Cd2+ was carried out at pH 7.3 by raising the pH of the apo-MT solution prior to the ... each of the domains Thus, the goal is to elucidate the metallation mechanisms of the individual domains, in the hope, initially, of simplifying the interpretation of the metallation details of the ... Elution of the protein with a low-pH eluant effectively removes the metal ions from the protein; they separate from the protein band through the size-exclusion processes on the column Preparation of...
- 9
- 533
- 0
Tài liệu Báo cáo khoa học: Characterization of ICAM-4 binding to the I domains of the CD11a/CD18 and CD11b/CD18 leukocyte integrins pptx
Ngày tải lên :
20/02/2014, 11:20
... fusion proteins were checked by SDS/PAGE The preparations contained the expected recombinant proteins and the purity of the proteins was >90% (not shown) Binding of red cells to purified I domains The ... knowledge the epitope for mAb 60.1 within the I domain has not been mapped in detail but the epitope for activation dependent mAb 7E3 has been localized to the amino-terminal region of the CD11b ... through a Bio-Gel P- 6DG column to remove glutathione For the experiments, which utilized the I domains separated from the GST moiety, the purified GST fusion proteins of the I domains of CD11a/CD18...
- 14
- 495
- 0
Tài liệu Combatting Heavy Equipment Theft - An Officer’s Guide to the Proper Identification of Construction Equipment docx
Ngày tải lên :
21/02/2014, 09:20
... PC150 PC180 PC200 PC210 PC220 PC228 PC250 PC270 PC280 PC300 PC350 PC400 PC600 PC750 PC800 PC1100 PC1250 PC2000 PC3000 PC4000 Serial Number Sample Digits, example A83462 17 Digits, example ... or under top step into cab Caterpillar Models CP44 CP56 CP64 CP74 CS44 CS54 CS64 CS74 CS76 CS323C CP-563C Serial Number Sample Pre 2001 – Digits,example 5JN00878 2001 – 17 Digits,example CAT0563CD5JN00878 ... cab Super Pac Models 540PD 600 8410 8420 Serial Number Sample Digits, example 101720 VIN# Location: Behind top step on Highway side Super Pac were made by Champion Champion was sold to Volvo...
- 40
- 613
- 0
Tài liệu Playing through: A Guide to the Unwritten Rules of Golf potx
Ngày tải lên :
22/02/2014, 08:20
... CHAPTER “ SPORTSMANSHIP ” Played the way it’s meant to be played, golf represents the essence of sportsmanship in athletics No other sport expects the participants to police themselves the way golf ... manuscript To all the respondents to the Post Golf Survey Your opinions and your stories provide the backbone of the advice here Thank you for taking the time to respond To all the people, golfers ... not even bother to tee off after Jane’s great shot Jane prevailed on Katherine to step up to the tee and make her shot anyway Lo and behold, Katherine’s shot dropped into the cup on top of Jane’s...
- 223
- 404
- 0
Fundamentals of NGO Management: A Practical Guide to the Financial Management of NGOs pot
Ngày tải lên :
06/03/2014, 21:20
... organisation, the same person should therefore not be performing the following duties: • preparation of bank reconciliations and approval thereof; • preparation of requisitions and approval of expenses; ... issued in duplicate One is handed to the employee and the second copy is kept by the employer The pay slip lists the following: • name of organisation • name of employee • period of payment • basic ... are paid to the administrators of the respective funds, inclusive of the employer’s contributions, if applicable Return forms are supplied by the institutions (See page 44: Annex 17 – Payslip)...
- 76
- 577
- 0
Báo cáo khoa học: The signature amidase from Sulfolobus solfataricus belongs to the CX3C subgroup of enzymes cleaving both amides and nitriles Ser195 and Cys145 are predicted to be the active site nucleophiles pot
Ngày tải lên :
07/03/2014, 21:20
... between the putative catalytic sites of the SsAH-WT and SsAH-K96R models with those of the peptide amide hydrolase 1M22 template The figure shows (in blue) the putative catalytic pocket of the SsAH-WT ... model (B) superimposed to the catalytic pocket of chain B of the template protein (orange) Both models show the Cys145Ala, Asp191Gln and Gln192Thr substitutions observed in the CX3C subgroup (SsAH ... One of its amino ˚ groups is about 2.6 A from the Oc atom of Ser171 ˚ and 2.5 A from the thiol group of Cys145 4720 Even taking into account all of the limitations of molecular models of proteins...
- 9
- 478
- 0
Báo cáo khoa học: Two conserved domains in regulatory B subunits mediate binding to the A subunit of protein phosphatase 2A pdf
Ngày tải lên :
08/03/2014, 10:20
... enhance the GST- A:B56a interaction Binding of B56a wild type protein to PP2A A was assessed in the presence or absence of lg of puri®ed PP2A C and/or 10 lL of 35 S-labeled PP2A C synthesized ... recovery may be due to a high level of nonspeci®c adsorption of the B56a polypeptides to the beads, and suboptimal binding in the absence of cotranslation of the A and C subunits The smallest N-terminal ... To optimize conditions for the assay, fulllength B56a was ®rst tested for binding to GST- A B56a full-length protein bound well to GST- A, but not to GST alone (Fig 1A) To further con®rm the speci®c...
- 7
- 550
- 0
Báo cáo Y học: Binding of Thermomyces (Humicola) lanuginosa lipase to the mixed micelles of cis-parinaric acid/NaTDC Fluorescence resonance energy transfer and crystallographic study ppt
Ngày tải lên :
08/03/2014, 23:20
... tryptophans) and an acceptor (fatty acid) is that there must exist a spectral overlap between the donor emission and the acceptor absorption spectra, and the donor and acceptor groups must be the ... that the lid is involved in the binding of the mixed micelles of cis-PnA/NaTDC On the other hand, these shifts might result from the quenching of the tryptophan fluorescence in the presence of the ... due to the very weak electron density but the position of the first atom of the cis C9–C10 bond was used to model the remaining part of thsis moiety in a similar manner to the model of one of the...
- 9
- 424
- 0
AN INTRODUCTION TO THE INTERNATIONAL LAW OF ARMED CONFLICTS doc
Ngày tải lên :
16/03/2014, 13:20
... Scope of Applicability 85 13 Applicability of the LOAC: Spatial Scope of Applicability 93 14 Applicability of the LOAC: Temporal Scope of Applicability 99 15 Applicability of the LOAC by Special ... the place of celebration of the marriage or to the law of the habitual residence of the couple? This collision of different internal laws will be solved by the application of particular rules These ... of different types: they may relate to weapons, for example poisoned weapons; to actual conduct, for example perfidy; to the use of certain classes of persons as military personnel, for example...
- 373
- 760
- 0
Báo cáo khoa học: Calcium-induced activation and truncation of promatrix metalloproteinase-9 linked to the core protein of chondroitin sulfate proteoglycans pot
Ngày tải lên :
17/03/2014, 10:20
... processed part of the core protein remains bound to the enzyme The calcium-induced activation and processing of the proMMP-9 bound to the CSPG core protein appeared to be a stepwise process First the ... activates the proMMP-9 in the complex in the presence of CaCl2 As TIMP-1 inhibits the CaCl2-induced activation of the MMP-9/CSPG complex, we investigated whether the THP-1 cells produced TIMP-1 Western ... investigated whether some of the TIMP-1 was bound to the proMMP-9/CSPG complex in spite of the dissociating conditions used to avoid unspecific binding during the isolation procedure In some of the purified...
- 12
- 381
- 0