... The multiple endocrine neoplasia type I gene locus is involved in the pathogenesis of type II gastric carcinoids Gastroenterology 1997, 113:773-781 Teh BT: Thymic carcinoids in multiple endocrine ... 1014:189-198 Marx SJ: Molecular genetics of multiple endocrine neoplasia types and Nat Rev Cancer 2005, 5:367-375 Page of 10 Doherty GM: Multiple endocrine neoplasia type J Surg Oncol 2005, 89:143-150 ... Boscaro M, Fallo F: Multiple endocrine neoplasia type and adrenal lesions J Urol 2001, 166:24-27 20 Gibril F, Schumann M, Pace A, Jensen RT: Multiple endocrine neoplasia type and Zollinger-Ellison...
Ngày tải lên: 09/08/2014, 01:24
... pancreaticoduodenal endocrine tumors in patients with multiple endocrine neoplasia type World J Surg 2004, 28:1317-1322 Skogseid B, Oberg K: Prospective screening in multiple endocrine neoplasia type Henry ... ultrasound; MEN1: multiple endocrine neoplasia type syndrome; MRI: magnetic resonance imaging; PET: pancreatoduodenal endocrine tumor; NIH: National Institutes of Health; PET: pancreatoduodenal endocrine ... LA: Multiple endocrine neoplasia type 1: clinical and genetic topics Ann Intern Med 1998, 129:484-494 Doherty GM, Olson JA, Frisella MM, Lairmore TC, Wells SA Jr, Norton JA: Lethality of multiple...
Ngày tải lên: 11/08/2014, 19:21
Báo cáo y học: " Safety and efficacy of undenatured type II collagen in the treatment of osteoarthritis of the knee: a clinical trial"
... Supplements Each UC -II (InterHealth Nutraceuticals, Inc., Benicia, CA) capsule contained 20 mg UC -II standardized to mg of bioactive undenatured type II collagen Subjects in the UC -II group were instructed ... in UC -II induced pharmacological anti-arthritic effects in humans, dogs or horses is not clearly established Type II collagen is the primary form of collagen contained in cartilage Type II collagen ... morning to protect blinding and two UC -II capsules in the evening accounting for a daily dose of 40 mg UC -II containing 10 mg of bioactive undenatured type II collagen Each G+C capsule contains...
Ngày tải lên: 26/10/2012, 09:48
Tài liệu Đường và Bệnh Tiểu Đường Type II doc
... Tiểu đường type II, bệnh mãn tính tụy tạng tiết không đủ insulin cần thiết, đủ insulin lại bị đề kháng (insulin ... học Âu Mỹ nói rằng, khơng có mối liên hệ trực tiếp cho thấy đường nguyên nhân gây bệnh diabetes type II Nhưng mặt sinh lý học, đường gây bệnh tiểu đường cách gián tiếp, chẳng hạn trường hợp thường ... tới bệnh diabetes Mập bụng (abdominal obesity) mối nguy (risk factor) làm xuất bệnh tiểu đường type II Trong thực tế, khó tách rời ảnh hưởng đường bệnh diabetes Thêm đường vào thức ăn thức uống...
Ngày tải lên: 21/01/2014, 21:20
Tài liệu Báo cáo khoa học: Membrane targeting and pore formation by the type III secretion system translocon pdf
... periplasmic rings in the type III secretion system Nat Struct Mol Biol 5, 468–476 ´ Akeda Y & Galan JE (2005) Chaperone release and unfolding of substrates in type III secretion Nature 437, 911–915 ... its type III secreton Mol Microbiol 39, 652–663 12 Marlovits TC, Kubori T, Lara-Tejero M, Thomas D, ´ Unger VM & Galan JE (2006) Assembly of the inner rod determines needle length in the type III ... (2003) Oligomerization of type III secretion proteins PopB and PopD precedes pore formation in Pseudomonas EMBO J 22, 4957– 4967 27 Troisfontaines P & Cornelis GR (2005) Type III secretion: more systems...
Ngày tải lên: 14/02/2014, 22:20
Tài liệu Báo cáo khoa học: TMPRSS13, a type II transmembrane serine protease, is inhibited by hepatocyte growth factor activator inhibitor type 1 and activates pro-hepatocyte growth factor pdf
... Netzel-Arnett S, Antalis TM & Bugge TH (2003) Type II transmembrane serine proteases Thromb Haemost 90, 185–193 Bugge TH, Antalis TM & Wu Q (2009) Type II transmembrane serine proteases J Biol Chem ... endogenous protease inhibitors, which include Kunitz -type inhibitors and serpins [2] Hepatocyte growth factor activator inhibitor type (HAI-1), a Kunitz -type serine protease inhibitor, is implicated ... than HAI-1–NK1 Hepatocyte growth factor activator inhibitor type (HAI-2), also known as placental bikunin, is also a transmembrane Kunitz -type serine protease inhibitor [15,16] HAI-2 has been shown...
Ngày tải lên: 15/02/2014, 01:20
Tài liệu Báo cáo khoa học: Octaketide-producing type III polyketide synthase from Hypericum perforatum is expressed in dark glands accumulating hypericins pdf
... not particularly closely related to any of the currently known type III PKSs, which indicates that it is a novel plant-specific type III PKS family protein We have previously reported that the deduced ... bioinformatics tools [25], and with that of a subunit size typical to plant-specific type III PKSs The plant-specific type III PKSs are reported to be homodimeric proteins with a subunit size of 40–45 ... reported to be produced by plant-specific type III PKS The hexaketide a-pyrone A1 produced by HpPKS2 can be classified as a derailment product of type III PKS The structure is also the product...
Ngày tải lên: 18/02/2014, 18:20
Tài liệu Báo cáo khoa học: Crystal structure of the catalytic domain of DESC1, a new member of the type II transmembrane serine proteinase family pptx
... J P Kyrieleis et al type (matriptase 1–3 and polyserase); hepsin ⁄ transmembrane proteinase, serine (TMPRSS) type (hepsin ⁄ MSPL ⁄ enteropeptidase, TMPRSS 2–5); and corin type (corin) The hepsin ... thrombin S1 pocket type because of the presence of an Ala rather than a Ser at position 190 The S1 specificity pockets of the TTSPs belong to the Ala190 -type (DESC1, hepsin) and serine190 -type (matriptase ... activator inhibitor type 2, a Kunitz -type serine protease inhibitor J Biol Chem 272, 27558–27564 Seguchi K, Kataoka H, Uchino H, Nabeshima K & Koono M (1999) Secretion of protease nexin -II ⁄ amyloid...
Ngày tải lên: 19/02/2014, 00:20
Tài liệu Báo cáo khoa học: Agrobacterium tumefaciens type II NADH dehydrogenase Characterization and interactions with bacterial and thylakoid membranes ppt
... algae, in addition to the photosynthetic electron transfer chain oxidizing water at photosystem II (PS II) and reducing NADP+ at photosystem I (PS I), the existence of a respiratory chain including ... CAB41986; S tuberosum (StNDB1), CAB52797; A thaliana (AtNDB1), NP_567801; C reinhardtii (N2Cr147), C reinhardtii (N2Cr247), S cerevisiae (NDI1), NP_013586; S cerevisiae (NDE1), NP_013865; S cerevisiae ... reinhardtii thylakoid membranes The increase in chlorophyll fluorescence was measured under low light in response to NADH addition (final concentration 200 lM) to a suspension of C reinhardtii thylakoids...
Ngày tải lên: 19/02/2014, 06:20
Tài liệu Báo cáo khoa học: Biochemical characterization of Bacillus subtilis type II isopentenyl diphosphate isomerase, and phylogenetic distribution of isoprenoid biosynthesis pathways doc
... putative idi-2 gene, the distribution of type I and type II isomerases in the prokaryotic kingdom appears to be mutually exclusive Genes specifying type II isomerases were found in 19 of 20 (95%) ... catalytic activity, the type II isomerase of Streptomyces sp CL190 has been reported to require FMN and NADPH as well as divalent metals [28] The structure of a type II IPP isomerase from Bacillus ... (designated type II) from Streptomyces sp CL190 [28] is devoid of sequence similarity to the previously known IPP isomerases of yeast and animal origin which are now designated type I Whereas type I...
Ngày tải lên: 19/02/2014, 13:20
Tài liệu Báo cáo khoa học: Co-operative effect of the isoforms of type III antifreeze protein expressed in Notched-fin eelpout, Zoarces elongatus Kner ppt
... Journal 272 (2005) 482–492 ª 2004 FEBS Co-operative effect of type III AFP isoforms We recently found that a significant amount of type III AFP can be purified from the minced muscles of Notched-fin ... the isoforms of nfeAFP 483 Co-operative effect of type III AFP isoforms Y Nishimiya et al A B Fig (A) HPLC purification of the isoforms of type III AFP from Notched-fin eelpout The peaks containing ... not exhibit 100% identity with any other reported sequences of type III AFP Based on the sequence similarity to the known type III AFP isoforms from Atlantic ocean pout [20], the 13 isoforms...
Ngày tải lên: 19/02/2014, 16:20
Đề tài " On a class of type II1 factors with Betti numbers invariants " pdf
... N, B and Tφα ∈ J ( N, B ), it follows that Tφα ∈ J ( N, B ) 2◦ We clearly have (ii) =⇒ (i) =⇒ (iii) Assume now (iii) holds true for the trace τ and let τ0 be an arbitrary normal, faithful tracial ... open questions in the theory of type II1 factors Thus, the factors M = A σ SL(2, Z) (more generally, A σ Γ0 with Γ0 , σ as above) provide the first class of type II1 factors with trivial fundamental ... that (M ) = R∗ when M is isomorphic to the + hyperfinite type II1 factor R, and more generally when M “splits off” R The first examples of type II1 factors M with (M ) = R∗ , and the first + occurrence...
Ngày tải lên: 06/03/2014, 08:21
Báo cáo khoa học: Effect of annealing time of an ice crystal on the activity of type III antifreeze protein pdf
... 65-residue type III AFP called nfeAFP8, which was recently discovered in the Notched-fin eelpout [20] nfeAFP8 exhibits 94% sequence identity 6470 with HPLC12, a well-examined type III AFP isoform ... remarkably flat and amphipathic surface is constructed on type III AFP, enabling complementary binding to the flat ice prism plane [14,21] When the type III AFP solution contains a seed ice crystal, the ... drawing of ice growth inhibition of type III AFP based on the ‘adsorption–inhibition’ model [3,4] (A) A convex ice front is created after primary binding of type III AFP onto the flat ice plane (B)...
Ngày tải lên: 07/03/2014, 05:20
Báo cáo khoa học: The product chain length determination mechanism of type II geranylgeranyl diphosphate synthase requires subunit interaction pptx
... fourth and fifth positions upstream from FARM, similar to type III GGPS, whereas it has a two amino acid insertion in FARM, as does type II FPS Unexpectedly, mutations at the fourth and fifth positions ... two amino acid insertion, which is specifically observed in type II FPS and type II GGPS, was expected to affect the product chain length Type I GGPS with the insertion mutation yielded larger amounts ... deletion of the insertion from type I FPS or type II GGPS), the insertion sequence was thought to play a role in the mechanism of chain length determination in type II GGPS Thus, in the present...
Ngày tải lên: 07/03/2014, 06:20
Báo cáo khoa học: An acridone-producing novel multifunctional type III polyketide synthase from Huperzia serrata pot
... from Ru graveolens is the only known type III PKS that selects N-methylanthraniloylCoA as a starter to produce a tetraketide acridone [8–10] Other type III PKSs, including regular CHS, not accept ... first plant type III polyketide synthase catalyzing formation of aromatic heptaketide FEBS Lett 562, 171–176 13 Abe I, Watanabe T & Noguchi H (2005) Chalcone synthase superfamily of type III polyketide ... pyrones by plant type III polyketide synthases Phytochemistry 65, 2447–2453 Abe I, Abe T, Wanibuchi K & Noguchi H (2006) Enzymatic formation of quinolone alkaloids by a plant type III polyketide...
Ngày tải lên: 07/03/2014, 10:20
Báo cáo khoa học: MR solution structure of the precursor for carnobacteriocin B2, an antimicrobial peptide fromCarnobacterium piscicola Implications of the a-helical leader section for export and inhibition of type IIa bacteriocin activity pdf
... The receptor for type IIa bacteriocins may involve an extracellular domain present in the MptD subunit of EIIMan of the mannose phosphot transferase system [44] Although these types of experiments ... MKNAKSLTIQEMKSITGG MMKKIEKLTEKEMANIIGG KYYGNGVSCNSHGCSVNWGQAWTCGVNHLANGGHGVC KYYGNGVTCGKHSCSVNWGQAFSCSVSHLANFGHGKC MKTVKELSVKEMQLTTGG MKSVKELNKKEMQQINGG KYYGNGVSCNKNGCTVDWSKAIGIIGNNAAANLTTGGAAGWNKG AISYGNGVYCNKEKCWVNKAENKQAITGIVIGGWASSLAGMGH ... AISYGNGVYCNKEKCWVNKAENKQAITGIVIGGWASSLAGMGH MMNMKPTESYEQLDNSALEQVVGG MKKIEKLTEKEMANIIGG KYYGNGVHCTKSGCSVNWGEAFSAGVHRLANGGNGFW KYYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATGGHQGNHKC MTNMKSVEAYQQLDNQNLKKVVGG KYYGNGVHCTKSGCSVNWGEAASAGIHRLANGGNGFW...
Ngày tải lên: 07/03/2014, 15:20
Báo cáo Y học: The refolding of type II shikimate kinase from Erwinia chrysanthemi after denaturation in urea pot
... protein In the present paper, we have undertaken a study of the unfolding and refolding of the type II SK from E chrysanthemi, using studies of CD, fluorescence, activity and ANS fluorescence, and ... Unfolding and refolding of SK was performed essentially as described in our previous studies on type II dehydroquinase [28] To study the extent of unfolding of SK, the enzyme was routinely incubated ... D.G., Coggins, J.R., Virden, R & Hawkins, A.R (1999) The folding and assembly of the dodecameric type II dehydroquinases Biochem J 338, 195–202 Pace, C.N (1990) Conformational stability of globular...
Ngày tải lên: 08/03/2014, 23:20
Viêm cầu thận màng tăng sinh type II potx
... glomerulonephritis (type II) ; Glomerulonephritis membranoproliferative (type II) ; Mesangiocapillary glomerulonephritis (type II) ; Dense deposit disease; MPGN II Định nghĩa Viêm màng cầu thận type II rối loạn ... hiển vi viêm màng cầu thận tăng sinh type II có phần hay thay đổi liên quan nhiều đến tế bào so sánh với viêm cầu thận màng tăng sinh type I (MPGN I) MPGN II có xu hướng xấu nhanh hơn, dẫn tới ... xếp gặp với chuyên gia chăm sóc sức khỏe bạn triệu chứng có viêm cầu thận màng tăng sinh type II (MPGN II) Hãy gọi điện thoại để xắp xếp gặp với chuyên gia chăm sóc sức khỏe bạn triệu chứng xấu...
Ngày tải lên: 12/03/2014, 05:20
Báo cáo khoa học: Fully active QAE isoform confers thermal hysteresis activity on a defective SP isoform of type III antifreeze protein docx
... of various AFP isoforms Type III AFP is a kDa globular protein that exhibits high sequence identity with the C-terminal domain of human sialic acid synthase [9,10] Type III AFP was first discovered ... binding by type III antifreeze proteins J Mol Biol 305, 875–889 Miura K, Ohgiya S, Hoshino T, Nemoto N, Suetake T, Miura A, Spyracopoulos L, Kondo H & Tsuda S (2001) NMR analysis of type III antifreeze ... mutations on the structure of type III antifreeze protein and its interaction with ice J Mol Biol 275, 515–525 23 Chen G & Jia Z (1999) Ice-binding surface of fish type III antifreeze Biophys J 77,...
Ngày tải lên: 16/03/2014, 04:20