microsphere a novel drug delivery system

Development and evaluation of a novel nanoparticulate delivery system of arsenic sulfides

Development and evaluation of a novel nanoparticulate delivery system of arsenic sulfides

... Indigo Naturalis tablets ( 复 方 青 黛 片 ) containing realgar, baphicanthus cusia, radix salviae mithiorrhyzae, radix pseudosatellariae, and pulverata levis to treat APL, achieving high CR rates [Huang ... treatment phase Mean age at diagnosis is about 40 years The male to female ratio is balanced [Groopman J and Ellman L, 1979] APL is characterized by rapid accumulation of immature granulocytes called ... asthma, rheumatism, haemorrhoids, cough, and pruritus, and are also prescribed as a health tonic, analgesic, anti-inflammatory agent, and as a treatment for some malignant tumors [Pan B et al., 2004]...

Ngày tải lên: 11/09/2015, 16:03

232 464 0
Development of novel drug delivery system   lipid microemulsion of tributyrin

Development of novel drug delivery system lipid microemulsion of tributyrin

... Propofol Anaesthetic Astra Zeneca Worldwide Intralipid N A Parenteral Nutrition Pharmacia & Upjohn US and Canada Limethason Dexamethasone Steroid Palmitate Liple Alprostadil Mitsubishi Japan Pharmaceutical ... of Symbols AUC: area under the curve; CL: total clearance; CL/F: appatent total clearance; Cmax: maximal plasma concentration; F: bioavailability; Ka: first-order absorption rate constant; Ke: ... TABLE 1-4 Examples of commercially available injectable lipid submicro-emulsions Trade Name Drug Indication Manufacturer Market Diazemuls Diazepam Sedative Pharmacia & Upjohn Worldwide Diprivan...

Ngày tải lên: 16/09/2015, 08:30

213 357 0
Drug Delivery Systems

Drug Delivery Systems

... important to note that the exact period of time for degradation and erosion is not stated exactly because there are competing physical factors that can greatly accelerate or retard biodegradation A ... the ability to control drug release kinetics via changes in surface area of the delivery system For PLGA systems, the relationship between polymer degradation, drug release, and surface area is ... retarded diffusion that accelerates as the PLGA component degrades For example, ReGel has been used to release an anticancer agent, paclitaxel, for approximately 50 days [40] 15.6.7 Peptide-Based...

Ngày tải lên: 25/10/2013, 08:20

16 424 2
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

... 277 283 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK *****::*.** : ... Toyobo (Osaka, Japan) Emulgen 911 was a gift from Kao Chemical (Tokyo, Japan) NADPH, NADH and NADP+ were purchased from Oriental Yeast (Tokyo, Japan) a- Cyano-4-hydroxycinnamic acid was obtained from ... :.:: : * : * NAYTAKAVIIAAGVGAFEPRRIGAPGEREFEGRGVYYAVKSKA-EFQGK-RVLIVGGGDS -EYTCDALIIATGASA -RYLGLPSEEAFKGRGVSACATCDG-FFYRNQKVAVIGGGNT LEVKARTVILAVGSRR -RKLGVPGEAELAGRGVSYCSVCDAPLFKGKDAVVVVGGGDS...

Ngày tải lên: 18/02/2014, 08:20

14 617 0
Chemical Aspects of Drug Delivery Systems pptx

Chemical Aspects of Drug Delivery Systems pptx

... Materials and Systems for Drug Delivery and Targeting Table Externally activated drug delivery systems EXTERNAL ACTIVATION FORMULATION SYSTEM MECHANISM FOR DRUG DELIVERY CONTROL HEAT LIPOSOMES CHANGE ... characteristics of the targets, including access and location, as well as the characteristics of any carrier materials incorporated into drug delivery systems 4 DRUG LEAKAGE+ +NON TARGET +METABOLISM ... drug delivery and targeting - route of administration, Figure carrier and target (adaptedfrom Florence4) CARRIER SYSTEMS In many cases, carrier materials are used in particulate forms, and Table...

Ngày tải lên: 28/03/2014, 10:20

174 344 0
THE CHEMISTRY OF DRUG DELIVERY SYSTEMS (hoá học các hệ dẫn truyền thuốc)

THE CHEMISTRY OF DRUG DELIVERY SYSTEMS (hoá học các hệ dẫn truyền thuốc)

... be achieve, patient and disease GLOBAL DRUG DELIVERY MARKET BY ADMINISTRATION MODE Nasal 2% Ocular 2% Injectable/ Implant 3% Transdermal 8% Inhalation 32% Oral 53% CLASSIFICATION OF DRUG DELIVERY ... first-pass effect of drug cleareance ORAL MUCOSAL ROUTE Classification:  Sublingual delivery  Buccal delivery  Local delivery Sublingual delivery Buccal delivery Surface area: 100 cm2 Local delivery ... SUBLINGUAL AND BUCCAL DELIVERY Sublingual delivery Buccal delivery High permeability Less permeability Higher rate of absorption Low rate of absorption Higher drug bioavailability Low drug bioavailability...

Ngày tải lên: 18/04/2014, 15:37

151 1,2K 10
nanoparticulate drug delivery systems, 2007, p.382

nanoparticulate drug delivery systems, 2007, p.382

... Formulation Characteristics 291 Jaspreet K Vasir and Vinod Labhasetwar 19 Gastrointestinal Applications of Nanoparticulate Drug- Delivery Systems 305 Maria Rosa Gasco 20 Nanoparticles as Adjuvant-Vectors ... Jerusalem, Jerusalem, Israel Juan M Irache Department of Pharmacy and Pharmaceutical Technology, University of Navarra, Pamplona, Spain K K Jain Jain PharmaBiotech, Basel, Switzerland Ashwath Jayagopal ... Lukyanov AN, Gao A, Papahadjopoulos B Immunomicelles: targeted pharmaceutical carriers for poorly soluble drugs Proc Natl Acad Sci USA 2003; 100:6039 Kabanov AV, Batrakova EV, Alakhov VY An essential...

Ngày tải lên: 04/06/2014, 14:47

382 414 0
Báo cáo sinh học: "Comparisons of three polyethyleneimine-derived nanoparticles as a gene therapy delivery system for renal cell carcinoma" doc

Báo cáo sinh học: "Comparisons of three polyethyleneimine-derived nanoparticles as a gene therapy delivery system for renal cell carcinoma" doc

... of apoptosis Cancer Gene Ther 2010, 17:212-222 Morikawa T, Sugiyama A, Kume H, Ota S, Kashima T, Tomita K, Kitamura T, Kodama T, Fukayama M, Aburatani H: Identification of Toll-like receptor as ... physic-chemical properties (size and charge) of each separate material, including PCFC-g-PEI and FA-PEAs, as well as the FA-PEAs: pVHL complexes Because PCFC-g-PEI and FA-PEAs are amphiphilic ... cationic HPEI nanogel was conjugated by 2-kD PEI and heparin Heparin is a biodegradable negative polysaccharide with many carboxylic groups, and PEI is a cationic polymer with many primary amine...

Ngày tải lên: 18/06/2014, 19:20

10 453 0
Báo cáo hóa học: " Nanotechnology-based drug delivery systems" pdf

Báo cáo hóa học: " Nanotechnology-based drug delivery systems" pdf

... Polyalkylcyanoacrylates (PACA) nanoparticles have been used as a carrier for targeting antileishmanial drugs into macrophages This nanomaterial did not induce interleukin-1 release by macrophages ... of the encapsulated therapeutic agent nanomaterials Polylactic/glycolic acid (PLGA) and polylactic acid (PLA) based nanoparticles have been formulated to encapsulate dexamethasone, a glucocorticoid ... potential pharmaceutical targets in many human and animal diseases Although macrophages are capable of killing most of the microbes, many microorganisms (Toxoplasma gondii, Leishmania sp, Mycobacterium...

Ngày tải lên: 20/06/2014, 00:20

6 590 0
báo cáo hóa học: " Reduced inclination of cervical spine in a novel notebook screen system - implications for rehabilitation" docx

báo cáo hóa học: " Reduced inclination of cervical spine in a novel notebook screen system - implications for rehabilitation" docx

... performed the analysis and interpretation of the data MFS, SU, KV, SM, BK: Participation in the analysis of data, revision of the manuscript All authors read and approved the final manuscript Received: ... musculoskeletal disease a global perspective Clinical rheumatology 2006, 25:778-781 Kambin P, Abda S, Kurpicki F: Intradiskal pressure and volume recording: evaluation of normal and abnormal cervical disks ... results a photo digital overlay Figure Study set-up The workstation with adjustable ergonomic chair and desk as well as the adaptable protractor are displayed Gender influence on cervical inclination...

Ngày tải lên: 20/06/2014, 00:20

6 536 0
báo cáo hóa học:" Comparisons of three polyethyleneimine-derived nanoparticles as a gene therapy delivery system for renal cell carcinoma" pot

báo cáo hóa học:" Comparisons of three polyethyleneimine-derived nanoparticles as a gene therapy delivery system for renal cell carcinoma" pot

... of apoptosis Cancer Gene Ther 2010, 17:212-222 Morikawa T, Sugiyama A, Kume H, Ota S, Kashima T, Tomita K, Kitamura T, Kodama T, Fukayama M, Aburatani H: Identification of Toll-like receptor as ... physic-chemical properties (size and charge) of each separate material, including PCFC-g-PEI and FA-PEAs, as well as the FA-PEAs: pVHL complexes Because PCFC-g-PEI and FA-PEAs are amphiphilic ... cationic HPEI nanogel was conjugated by 2-kD PEI and heparin Heparin is a biodegradable negative polysaccharide with many carboxylic groups, and PEI is a cationic polymer with many primary amine...

Ngày tải lên: 20/06/2014, 03:20

10 306 0
Báo cáo hóa học: " The application of carbon nanotubes in target drug delivery systems for cancer therapies" docx

Báo cáo hóa học: " The application of carbon nanotubes in target drug delivery systems for cancer therapies" docx

... Allen BL, Conroy J, Volkov Vlasova Y, Belikova NA, Yanamala N, Kapralov A, Tyurina YY, Shi J, Kisin ER, Murray AR, Franks J, Stolz D, Gou P, Klein-Seetharaman J, Fadeel B, Star A, Shvedova AA: ... M, Yamamoto M, Hashiba M, Mizuguchi Y, Lee BW, Kuroda E, Shimada M, Wang WN, Yamamoto K, Fujita K, Endoh S, Uchida K, Kobayashi N, Mizuno K, Inada M, Tao H, Nakazato T, Nakanishi J, Tanaka I: ... Solubilization of single-wall carbon nanotubes by supramolecular encapsulation of helical amylose J Am Chem Soc 2003, 125:4426-4427 Numata M, Asai M, Kaneko K, Bae AH, Hasegawa T, Sakurai K, Shinkai...

Ngày tải lên: 20/06/2014, 22:20

22 848 0
Báo cáo hóa học: " Combination of Polymer Technology and Carbon Nanotube Array for the Development of an Effective Drug Delivery System at Cellular Leve" pptx

Báo cáo hóa học: " Combination of Polymer Technology and Carbon Nanotube Array for the Development of an Effective Drug Delivery System at Cellular Leve" pptx

... alginate as drug reservoir embedded into the platform Among polymers, alginate has several unique properties that have allowed it to be used as a matrix for the entrapment and/or delivery of a variety ... pure argon as sputtering gas) CNT Array: Properties, Imaging and Coating Alginate Thin Film Design, Production and Characterization Vertically aligned CNT arrays were provided from NanoLab, Inc ... behaviour at the neuronal interface Finally, CNT-based interfaces, as demonstrated, could be used for controlled drug delivery: any bioactive factor could be released in a spatially and temporally...

Ngày tải lên: 22/06/2014, 00:20

6 485 0
Báo cáo y học: "Screening of an endothelial cDNA library identifies the C-terminal region of Nedd5 as a novel autoantigen in systemic lupus erythematosus with psychiatric manifestations" ppt

Báo cáo y học: "Screening of an endothelial cDNA library identifies the C-terminal region of Nedd5 as a novel autoantigen in systemic lupus erythematosus with psychiatric manifestations" ppt

... the ELISA experiments and participated in analysis of data CA performed the statistical analysis and the clinical associations AS participated in the analysis and interpretation of data and in ... study, participated in its design and coordination, and drafted the manuscript All authors read and approved the final manuscript Acknowledgements An association between serum AECAs and psychosis ... Psychiatric Association; 1994 14 Margutti P, Delunardo F, Sorice M, Valesini G, Alessandri C, Capoano R, Profumo E, Siracusano A, Salvati B, Rigano R, et al.: Screening of a HUAEC cDNA library...

Ngày tải lên: 09/08/2014, 06:23

8 375 0
Ophthalmic Drug Delivery Systems - part 1 pptx

Ophthalmic Drug Delivery Systems - part 1 pptx

... Ramaknshnan Nagarajan 64 Achieving Sterility in Medical and Pharmaceutical Products, Nigel A Halls 65 Multiparticulate Oral Drug Delivery, edited by Isaac Ghebre-Sellassie 66 Colloidal Drug Delivery ... Eye Gangadhar Sunkara and Uday B Kompella 13 General Considerations in Ocular Drug Delivery James E Chastain 59 II Transport Models in Ocular Drug Delivery Ocular Drug Transfer Following Systemic ... Tse Clinical Drug Trials and Tribulations, edited by Alien E Cato Transdermal Drug Delivery Developmental Issues and Research Initiatives, edited by Jonathan Hadgraft and Richard H Guy Aqueous...

Ngày tải lên: 10/08/2014, 00:20

62 257 0
Ophthalmic Drug Delivery Systems - part 2 pdf

Ophthalmic Drug Delivery Systems - part 2 pdf

... Mazuel, C., Quint, M., and Rozier, A (1977) Pharmacokinetics and biopharmaceutical aspects of some anti-glaucoma drugs In: Ophthalmic Drug Delivery Biopharmaceutical Technological and Clinical ... with enhanced discriminative capabilities used to characterize inter-compartmental drug transfer have primarily characterized the ocular pharmacokinetics and pharmacodynamics of antibiotics, antifungals, ... noncorneal pathways, which are in parallel with corneal absorption, include conjunctival uptake and drainage via the nasolacrimal duct Both lead to systemic absorption by way of conjunctival blood...

Ngày tải lên: 10/08/2014, 00:20

57 205 0
Ophthalmic Drug Delivery Systems - part 4 doc

Ophthalmic Drug Delivery Systems - part 4 doc

... lomefloxacin in the anesthetized rabbit (48,49) Fukada et al (48) characterized the ocular pharmacokinetics (Cmax , Tmax , T1=2 ) of ofloxacin Sato et al [of the same laboratory as Fukada (49)] were able ... plasma concentrations The taurine level was approximately 70% that of plasma A comparison with CSF shows that all amino acids except for glutamine and phosphoethanolamine (PEA) are present at ... pharmacological agent The time-course data are approximated mathematically employing nonlinear least-squares regression analysis in order to obtain aqueous humor flow parameters perturbed by drugs that a ect...

Ngày tải lên: 10/08/2014, 00:20

58 330 0
Ophthalmic Drug Delivery Systems - part 5 doc

Ophthalmic Drug Delivery Systems - part 5 doc

... enzyme activity A summary of ocular penetration enhancers is shown in Table (14) Typically, ocular penetration enhancement falls into two categories: paracellular and transcellular A Enhanced Paracellular ... (Swarbrick J and Boylan J C (eds.), Marcel Dekker, New York, 1999, pp 1–27 14 Sasaki, H., Yamamura, K., Mukai, Nishida, K., Nakamura, J., Nakashima, M., and Ichikawa, M Enhancement of ocular drug ... a Data obtained from Alcon Surgical (Fort Worth, TX) Allergan, Inc (Irvine, California) and Oasis have a similar product called KeraShield and SoftShield, respectively b Data obtained from Bausch...

Ngày tải lên: 10/08/2014, 00:20

61 188 0
Ophthalmic Drug Delivery Systems - part 6 docx

Ophthalmic Drug Delivery Systems - part 6 docx

... strategies to maximize the ratio of ocular to systemic absorption, J Ocul Pharmacol., 3:159–170 63 Maitani, Y., Yamamoto, T., Takayama, K., Peppas, N A. , and Nagai, T (1995) A modelling analysis ... natural prostaglandins and their ester prodrugs and analogs across human ocular tissues in vitro, J Ocul Pharm Ther., 14:389–399 124 Sasaki, H., Nagano, T., Yamamura, K., Nishida, K., and Nakamura, ... adrenergic agents induces viral reactivation in animals that harbor latent HSV-1 strain McKrae Studies with propranolol, also a b-adrenergic antagonist, have yielded paradoxical results Kaufman et al...

Ngày tải lên: 10/08/2014, 00:20

63 278 0
Ophthalmic Drug Delivery Systems - part 8 docx

Ophthalmic Drug Delivery Systems - part 8 docx

... Hallnas, K., Dafgard, E., and Hoog, A (1990) Panretinal photocoagulation aggravates experimental proliferative vitreoretinopathy, Graefes Arch Clin Exp Ophthalmol., 228:461 58 Garcia-Layana, A. , ... M., Pastor, J C., Saornil, M A. , Goldaracena, M B., Layana, A G., Gayoso, M J., and Guisasola, J (1992) Intravitreal and subretinal proliferation induced by platelet-rich plasma injection in rabbits, ... Neovascularization complicates the treatment of many retinal diseases, and, therefore, appropriate animal models are needed A Laser-Induced Neovascularization Subretinal neovascularization (NV) can...

Ngày tải lên: 10/08/2014, 00:20

64 257 0
w