methods for determining the gpx activity

... assay of RNA concentration for monkey studies RNA isolation was performed as described above for the human blood assay The pilot work for the assay was performed on the Human Immune TLDA (ABI), ... selected for inclusion on a custom TLDA designed for the monkey studies If the assay for the human gene was capable of measuring the monkey transcript, the human assay was retained on the custom ... for 10 minutes, 37°C for hours, 85°C seconds and then hold at 4°C If TLDA amplification reactions were not performed on the same day as cDNA synthesis, the cDNA samples were stored at -20°C The...

Ngày tải lên: 18/06/2014, 16:20

... range These are of the form Δσ m N = constant, where Δσ is the stress range, N is the fatigue life and m is the inverse slope of the log Δσ vs log N curve The benefits from the use of the improvement ... Reasonable efforts have been made to publish reliable data and information, but the authors and the publisher cannot assume responsibility for the validity of all materials Neither the authors nor the ... (arrowed) Fig 5.5 The diameter of the tool tip influences the resulting appearance of the hammer peened surface In general, the smaller the diameter, the greater the likelihood that the actual weld...

Ngày tải lên: 24/03/2014, 02:20

... of the folding out membraneand form of the impulse (2) By any form of the impulse yields the products of the folding out membraneand form of an impulse (3) By any form of the impulse yields the ... products of the folding out membraneand form of an impulse (4) Any form of the impulse is yielded by the interaction of the bending out of the membrane and the form of the impulse (5) The impulse ... impulse (5) The impulse in any form yields the products of the folding-out membrane and the form of an impulse (6) Any form of the impulse yields the products of the membrane-folding Published...

Ngày tải lên: 30/03/2014, 17:20

... time than the LSM or the MLE (Al-Fawzan 2000) Although the results from the LSM and the MLS estimated methods were inferior to the MOM based on the MSE criterion in this study, the LSM and the MLE ... LSM improves the fitting of the distribution because more information is used than in the MOM CONCLUSION In this study, the good results of the MOM in terms of the number of times for the lowest ... pared the Weibull distribution estimation methods of both PCT and MLE based on the mean square error (MSE) in which there is a difference between the estimate and the true value of the parameter They...

Ngày tải lên: 07/08/2014, 10:22

... the shadehouse during the period the light metre was exposed, and the mean among the five quantum sensors for the total integrated light energy (mol m–2) received for the period ending when the ... restrict the input gap fractions to some central zenithal annuli The calculations that they perform are based on the same hypotheses as the ones used by the LAI-2000 PCA 2.6 Diazo papers The diazo ... (the LAI2000 PCA was not used for seedlings) discriminated the recent treefall gap from the other sites The LAIL and diazo papers did not make any distinction within the other sites, whereas the...

Ngày tải lên: 08/08/2014, 14:21

... ratio of the summation of the total incoming loads to that of the total outgoing loads (Eq 4) the volume (or flow rate) for that period The equation below is used for the determination of the EMC: ... Although the other methods are always useful to assess the overall average efficiency of the treatment system, the ROR method gave the highest confidence in reporting the overall efficiency of the ... 0.967 (P=0.002) The SOL method was next, and also significantly correlated with the other three methods, with a minimum r value of 0.926 (P=0.0027) On the other hand, the ER and ROL methods were...

Ngày tải lên: 11/10/2014, 02:19

... the bottom of e the slab If the underside of the slab is exposed to fire, the bottom of the slab will expand more than the top, resulting in a deflection of the slab The tensile strength of the ... against the surrounding part of the slab In turn, the unheated part of the slab exerts compressive forces on the heated portion The compressive force, or thrust, acts near the bottom of the slab ... range The thermal properties of concrete form the input information for heat flow studies aimed at determining the temperature distribution in concrete elements exposed to fires Together with information...

Ngày tải lên: 24/10/2014, 15:47

Ngày tải lên: 14/11/2014, 07:27

Ngày tải lên: 14/11/2014, 13:22

... 2.1.1 Exact Methods for the TSP …………………………….………13 2.1.2 Heuristic Methods for the TSP………….………….… ….… 16 2.2 Approaches for Solving the VRP……………………….…….….……… 31 2.2.1 Exact Methods for the VRP ………………….…….… ... assumed that the delivery is performed before the pickup for each customer location, and therefore, the current load of the vehicle before arriving at a given location can be calculated by the initial ... one of the following criteria: • The node resulting in the least distance increment • The node nearest to the current tour • The node farthest from the current tour • The node forming the largest...

Ngày tải lên: 04/10/2015, 15:58

... different from the ones (according to the indirect method) In the most case, the former was lower than the latter The variation between them was from 1.40% (DK888) to 6.17% (LCH9) Therefore, the difference ... measured by the direct method were different from the ones by the indirect method of Ewan (1989) The difference between them was in two sides, the higher one and the lower one The variation in the GE ... were starved for 32 hours (to empty the digestive tract), clean all experimental birds: combed their feathers, clean their paws Fed test ingredients for an hour and recorded feed intake The excreta...

Ngày tải lên: 06/08/2014, 18:22

... exhibited the greatest activity, and the washing-extracted polymer possessed the lowest Among the cations tested, calcium and magnesium ions showed the greatest benefit on activity These results ... flocculating activity for several kinds of suspensions, although the polymer yield was low Here, we compared four different extraction methods, measured polymer yields, determined the components of the ... control test was calculated every minute using the following formula: The relative A660 = A660 of flocculating test A660 of control test For the control, the polymer solution was replaced by distilled...

Ngày tải lên: 05/09/2013, 09:08

... [13] Due to the neglect of the dynamic saturation gradients, the steep saturation gradients near the front at early time decayed at later stages Therefore, for the long-term CR process, the Washburn ... to the experiment, a stable water level in the reservoir was kept by the overhead tank Once the bottom of the capillary tube contacted with water in the reservoir, the dynamic movement of the ... Z R） (1) where h is the CR height, K is the permeability, L is the length of the capillary tube, Pc is the macroscopic capillary pressure, φ is the porosity, µ1 and µ are the viscosity of water...

Ngày tải lên: 05/09/2013, 17:03

... completing the above steps, you will discuss your responses with the class The instructor will write the class consensus on a flip chart Use the space below for brainstorming Activity 7.2: Determining ... assigned by the instructor Identify the level of impact — high, medium, or low — that each technology type would have on the given layer of a Windows DNA design Write your answers in the grid provided ... 50 Activity 7.2: Determining the Impact of Technology on a Windows DNA Design Exercise 1: Determining Technology Implications ! Determine technology...

Ngày tải lên: 21/12/2013, 06:16

... precision values above 50% for the rst 10% of the list, but is outperformed by the t-test afterwards Looking at the rst 40% of the data, there is a big gap between the good measures (t-test, ... misleading results For instance, if we just look at the rst of the SLs for the PNV data, we might conclude that the t-test and frequency measures are equally well suited for the extraction of ... the precision (or recall) values achieved For instance, the precision values for and for the AdjN data can be read from the -axis in Figure at positions where and (marked by vertical lines) The...

Ngày tải lên: 20/02/2014, 18:20

... a3 integrin gene The map (upper line) shows the organization of exons 1–3 and the 5¢-flanking region with the positions for HindIII (H) and EcoRI (E) The restriction map for the 5¢-flanking region ... IV [57] The former enzyme is responsible for the synthesis of the b1–6 branch in N-acetyllactosamine units in cell surface N-glycans, and the latter enzyme is involved in the synthesis of cell ... for PCR The other two bands, which seem to be derived from the 5¢-cap site-labeled cDNA for the integrin a3 subunit gene, were separately excised and DNA fragments were extracted Subcloning the...

Ngày tải lên: 21/02/2014, 03:20

... flat volatilities for the pricing of the caps with the Ho-Lee model The strikes or cap rates of the caps are at the money, which means 48 they equal the value of the underlying forward rate We ... end the 12 contract on time and is able to pay for the debts The party with the short position in the futures contract agrees to sell the underlying commodity for the price and date fixed in the ... tn+1 ) is the discount factor for the period from t to tn+1 , f (t, tn , tn+1 ) is the forward rate at time t for the period between tn and tn+1 , and N is the normal distribution The tenor is...

Ngày tải lên: 06/03/2014, 08:20

... in the ATP hydrolysis site) Therefore, although the sequence at the end of the C-terminal helix is essential for ATPase activity and assembly in vitro, this requirement can be bypassed by the ... by their first three amino acids The TRP sequence (TRPTVNEDDLLK) is at the start of the helix, whereas the RDF sequence (RDFGQEGN) is at the end of the helix (Fig 1B,C) To determine whether the ... [23] Therefore, we next considered the possibility that deletion of the RDF sequence may disrupt the function of the SRH motif and thereby affect assembly and ATPase activity If this were true, then...

Ngày tải lên: 07/03/2014, 05:20

... FEHKRKELEQVCNPIISGLYQGAGGPGPGGFGA The fluorescein-label was directly coupled to the amino-termini of the peptides b The fluorescein-label was directly coupled to the aminotermini of the peptides, except for the Pyrr-10-20-K(Fl) ... every experiment, and therefore data are provided only for the 1-9 analog that had been scrutinized for its ATPase inhibitory activity earlier [6] The fluorescence signal of the two C-terminal analogs ... medium The assay was performed in poor broth medium Antibacterial activity of pyrrhocoricin analogs The Ala- and Tyr-scans identified the N-terminus as the fragment carrying essential residues for the...

Ngày tải lên: 08/03/2014, 10:20

... Printed in the United States of America 10 09 08 07 NOT FOR PRINTING OR INSTRUCTIONAL USE iii W Learning Objectives For: BUILDING & CLOSING THE SALE The objectives for Building & Closing the Sale ... presentations products and how to present them would be a broad band in the middle of the illustration, and techniques for closing the sale would be the large base of the triangle PR EV Using a marriage ... will address closing skills The logic is simple—if the “Ben Franklin” close does not work, the participant is then taught to rummage around in his or her head for the “puppy dog,” “secondary...

Ngày tải lên: 23/03/2014, 11:20