methodology for a novel programming model approach

Báo cáo hóa học: " Optimization of capsid-incorporated antigens for a novel adenovirus vaccine approach" doc

Báo cáo hóa học: " Optimization of capsid-incorporated antigens for a novel adenovirus vaccine approach" doc

... motif- AAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEA NSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAA SGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQ SNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQPEVEK ... GGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQ PEVEKPQKKP TEQGGGGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAA APAAQPEVEKPQKKPVIKPL Core Arg-Gly-Asp (RGD) motif italicized ... CGGGATCCCGGTTTCTTCTGAGGCTTCTCG CGGGATCCGGTGGCGCAGGCGG 83RGD -(as) 83RGD - (a) CGGGATCCCAGGGGTTTGATCACCGGTTT CGGGATCCACCGAACAGGGCGGGG 3'HVR5-(as) 5'HVR2-(s) GGCATGTAAGAAATATGAGTGTCTGGG CTCACGTATTTGGGCAGGCGCC a antisense,...

Ngày tải lên: 20/06/2014, 01:20

13 419 0
Báo cáo khoa học: A novel 2D-based approach to the discovery of candidate substrates for the metalloendopeptidase meprin pot

Báo cáo khoa học: A novel 2D-based approach to the discovery of candidate substrates for the metalloendopeptidase meprin pot

... Kristiansen TZ, Jonnalagadda CK, Surendranath V, Niranjan V, Muthusamy B, Gandhi TK, Gronborg M et al (2003) Development of human protein reference database as an initial platform for approaching systems ... database (release 48.8) with fixed carbamidomethyl modification of cysteine residues, variable oxidation of methionine and variable deamidation of asparagine and glutamine Parent and fragment mass ... and (D) annexin A1 The migration positions of molecular mass standards and protein loading amounts are indicated IEF ⁄ SDS ⁄ PAGE-based investigation, a commercially available colloidal Coomassie...

Ngày tải lên: 07/03/2014, 06:20

20 506 0
Báo cáo khoa học: "A Novel Word Segmentation Approach for Written Languages with Word Boundary Markers" pptx

Báo cáo khoa học: "A Novel Word Segmentation Approach for Written Languages with Word Boundary Markers" pptx

... data Since the test data tend to have a similar error rate to the narrow standard deviation, we computed the overall performance over the average word spacing error rate, which is 9.1% The baseline ... data and randomly insert spacing errors from 0% to 20% in the same way in which we made the development data We feel that this strategy can model both the intentional and un-intentional human ... using the relative frequency information of the training data, and a smoothing technique is applied to relieve the datasparseness problem which is the linear interpolation of n-grams that are used...

Ngày tải lên: 17/03/2014, 02:20

4 268 0
Báo cáo sinh học: " A reduced animal model approach to predicting total additive genetic merit for marker-assisted selection" ppsx

Báo cáo sinh học: " A reduced animal model approach to predicting total additive genetic merit for marker-assisted selection" ppsx

... the AM approach was presented first by Fernando and Grossman (1989), and its RAM version was described by Cantet and Smith (1991) These AM and RAM approaches permit best linear unbiased estimation ... random effects in the model [3] are then expressed as As described The by proposed van Arendonk et al RAM approach (1994), the mixed model equations are for MAS and v in equation [1]can be partitioned ... !11! For this model (12!, the ap and are given by where the matrix R is can be arranged as assumptions for expectations and dispersion parameters of expressed and then the elements of are as calculated...

Ngày tải lên: 09/08/2014, 18:22

10 405 0
Báo cáo y học: "A novel preclinical model for rheumatoid arthritis research" pdf

Báo cáo y học: "A novel preclinical model for rheumatoid arthritis research" pdf

... Compared to the macaque models, the marmoset model of CIA shows several advantages First of all, common marmosets are smaller and reach their adult age earlier than macaques, which saves capacity ... type II collagen an experimental model of arthritis J Exp Med 1977, 146:857-868 Cathcart ES, Hayes KC, Gonnerman WA, Lazzari AA, Franzblau C: Experimental arthritis in a nonhuman primate I Induction ... preclinical studies Aside from the advantages of using marmosets, a main drawback of this model should be considered The evolutionary distance between marmosets and humans is significantly larger than...

Ngày tải lên: 12/08/2014, 15:22

2 176 0
Tài liệu Báo cáo khoa học: "A Novel Feature-based Approach to Chinese Entity Relation Extraction" ppt

Tài liệu Báo cáo khoa học: "A Novel Feature-based Approach to Chinese Entity Relation Extraction" ppt

... therefore reasonable to conclude that kernel-based especially tree-kernel approaches are not suitable for Chinese, at least at current stage In this paper, we study a feature-based approach that ... Feature Space for Relation Extraction In proceedings of NAACL/HLT, pages 113-120 Nanda Kambhatla 2004 Combining Lexical, Syntactic, and Semantic Features with Maximum Entropy Models for Extracting ... incorporated the base phrase chunking information and semi-automatically collected country name list and personal relative trigger word list Jiang and Zhai (2007) then systematically explored a large...

Ngày tải lên: 20/02/2014, 09:20

4 480 0
Báo cáo khoa học: A novel mass spectrometric approach to the analysis of hormonal peptides in extracts of mouse pancreatic islets ppt

Báo cáo khoa học: A novel mass spectrometric approach to the analysis of hormonal peptides in extracts of mouse pancreatic islets ppt

... Chrisler, W.B., Thrall, B.D & Smith, R.D (2001) Quantitative analysis of bacterial and mammalian proteomes using a combination of cysteine a nity tags and 15N-metabolic labeling Anal Chem 73, 2132–2139 ... ethical committee for animal research (Lund, Sweden) Islet isolation and sample handling Preparation of isolated pancreatic islets from the mouse was performed by retrograde injection of a collagenase ... potential was )1 V and the anode potential was 10 V Both end-plate potentials of the ion trap were set at 1.5 V and the duration of the electron pulse was 100 ms Data acquisition and handling Primary...

Ngày tải lên: 17/03/2014, 10:20

7 491 0
Báo cáo hóa học: " Research Article A Novel Secure Localization Approach in Wireless Sensor Networks" pot

Báo cáo hóa học: " Research Article A Novel Secure Localization Approach in Wireless Sensor Networks" pot

... Locator Sensor Attacker S3 L5 L2 Locator Sensor Attacker (a) (b) Figure 1: The attack scenarios in WSN (a) Attacker model in range-based localization; (b) Attacked locators with temporal and spatial ... + dn 3.3 Attack Model In this paper, we consider an adversarial WSN where a pair of colluding attackers can launch a socalled distance-consistent spoofing attack In [9], the attacker can only revise ... localization process and marks itself a state after the localization The sensor marks itself with an attacked state if it detects any attacked locator; otherwise, it marks itself with a safe state...

Ngày tải lên: 21/06/2014, 11:20

12 397 0
Báo cáo sinh học: " Research Article A Double S-Shaped Bifurcation Curve for a Reaction-Diffusion Model with Nonlinear Boundary Conditions" doc

Báo cáo sinh học: " Research Article A Double S-Shaped Bifurcation Curve for a Reaction-Diffusion Model with Nonlinear Boundary Conditions" doc

... Yeh, “Exact multiplicity of solutions and S-shaped bifurcation curves for the p-Laplacian perturbed Gelfand problem in one space variable,” Journal of Mathematical Analysis and Applications, ... bifurcation diagram for β Again the double S-shape appears but in this case the Ss overlap, yielding exactly positive solutions for a certain range of λ Acknowledgment Eun Kyoung Lee was supported ... S V Parter, “Solutions of a differential equation arising in chemical reactor processes,” SIAM Journal on Applied Mathematics, vol 26, pp 687–716, 1974 12 D H Sattinger, A nonlinear parabolic...

Ngày tải lên: 21/06/2014, 16:20

23 229 0
Báo cáo sinh học: " Research Article Multiplicative Noise Removal via a Novel Variational Model" doc

Báo cáo sinh học: " Research Article Multiplicative Noise Removal via a Novel Variational Model" doc

... processing based on the linear RGB color models can be classified into two categories—the channelby-channel approach and the vectorial approach Compared with the first approach, the second approach can ... as data fitting term and the total variation seminorm as regularizer A variational model involving curvelet coefficients for cleaning multiplicative Gamma noise was considered in [23] As information ... converted the multiplicative model into an additive one by taking logarithms and proposed Bayesian type variational model Steidl and Teuber [22] introduced a variational restoration model consisting...

Ngày tải lên: 21/06/2014, 16:20

16 225 0
Báo cáo hóa học: " Research Article LCMV Beamforming for a Novel Wireless Local Positioning System: Nonstationarity and Cyclostationarity Analysis" doc

Báo cáo hóa học: " Research Article LCMV Beamforming for a Novel Wireless Local Positioning System: Nonstationarity and Cyclostationarity Analysis" doc

... data j j length for Rq estimation If yq [n] is a stationary and ergodic process, the sample average equals time average, and the sample covariance matrix estimator leads to an accurate estimate ... studied separately for more than fifty years In recent decades, a joint consideration of beamforming and cyclostationarity (i.e., beamforming for cyclostationary signals) attracted certain attention ... Transactions on Antennas and Propagation, vol 47, no 2, pp 233–241, 1999 [14] L C Godara, “Application of antenna arrays to mobile communications—part II: beam-forming and direction-ofarrival...

Ngày tải lên: 22/06/2014, 19:20

12 308 0
Báo cáo hóa học: "MULTIPLE PERIODIC SOLUTIONS FOR A DISCRETE TIME MODEL OF PLANKTON ALLELOPATHY" potx

Báo cáo hóa học: "MULTIPLE PERIODIC SOLUTIONS FOR A DISCRETE TIME MODEL OF PLANKTON ALLELOPATHY" potx

... Ginzburg, and H R Akcakaya, Variation in plankton densities among lakes: a case for ratio-dependent predation models, The American Naturalist 138 (1991), 1287–1296 [2] J Chattopadhyay, Effect ... (1.2) Assume that the average growth rates in (1.2) change at equally spaced time intervals and estimates of the population size are made at equally spaced time intervals, then we can incorporate ... Physiology and Biochemistry, edited by W D P Stewart, University of California Press, California, 1974 [8] Y Kuang, Delay Differential Equations with Applications in Population Dynamics, Mathematics...

Ngày tải lên: 22/06/2014, 22:20

14 307 0
Báo cáo hóa học: " DNA Microarray Data Analysis: A Novel Biclustering Algorithm Approach" potx

Báo cáo hóa học: " DNA Microarray Data Analysis: A Novel Biclustering Algorithm Approach" potx

... biclustering algorithm that can be used to extract from a set of data biclusters with constant values, constant values on rows, constant values on columns, and coherent values We also described an approach ... mathematical modeling and analysis of biological systems and data (genomics, proteomics, DNA microarray, gene expression, gene regulatory networks, and computational biology.) He did work as an ... downregulated across a subgroup of conditions without taking into account their actual expression values To extract such biclusters from a DNA microarray experimental data, we use the following approach...

Ngày tải lên: 22/06/2014, 23:20

12 316 0
Báo cáo khoa học: " Evidence for a novel gene associated with human influenza A viruses" pptx

Báo cáo khoa học: " Evidence for a novel gene associated with human influenza A viruses" pptx

... Talon J, Salvatore M, O'Neill RE, Nakaya Y, Zheng H, Muster T, Garcia-Sastre A, Palese P: Influenza A and B viruses expressing altered NS1 proteins: A vaccine approach Proc Natl Acad Sci USA ... translation of an ORF from an influenza A virus genomic RNA, however, these data reinforce the fact that molecular processes are not perfect and that errors in transcriptional and translational ... www.cdc.gov/mmwr/preview/mmwrhtml/mm581 7a1 .htm] Steel J, Lowen AC, Pena L, Angel M, Solorzano A, Albrecht R, Perez DR, Garcia-Sastre A, Palese P: Live attenuated influenza viruses containing NS1 truncations as vaccine candidates against...

Ngày tải lên: 12/08/2014, 04:20

12 253 0
Báo cáo y học: " Characterization of the innate immune response to chronic aspiration in a novel rodent model" ppsx

Báo cáo y học: " Characterization of the innate immune response to chronic aspiration in a novel rodent model" ppsx

... and with data analysis BL carried out the cytokine analysis, and helped prepare figures for the manuscript CH assisted with animal care and organ preparation for histologic examination, assisted ... standard error of the mean Chi-square, ANOVA, and unpaired Student's t-tests were performed, where appropriate For all statistical calculations, a p-value < 0.05 was considered significant Page ... (40 mg/kg IM), intubated orotracheally using the sheath from a 14-gauge IV catheter, and maintained on a mechanical ventilator (Inspira, Harvard Apparatus, Holliston, MA) Rats were subsequently...

Ngày tải lên: 12/08/2014, 15:21

12 330 0
Báo cáo khoa học: "Case report: severe heat stroke with multiple organ dysfunction – a novel intravascular treatment approach" doc

Báo cáo khoa học: "Case report: severe heat stroke with multiple organ dysfunction – a novel intravascular treatment approach" doc

... analysis of clinical data KE and CB participated in analysis of CoolGard 3000® data PL helped to draft the manuscript All authors read and approved the final manuscript References R501 Bouchama ... iced gastric lavage treatment of heatstroke: comparative efficacy in a canine model Crit Care Med 1987, 15:748-750 Megarbane B, Resiere D, Delahaye A, Baud FJ: Endovascular hypothermia for heat ... (glutamic-oxaloacetic transaminase 312U/l (normal range: 10 to 50 U/l), glutamic-pyruvic transaminase 244 U/l (normal range: 10 to 50 U/l), gamma-glutamylcyclotransferase 94 U/l (normal range:...

Ngày tải lên: 12/08/2014, 22:22

4 261 0
Báo cáo y học: " Characterization of a new 5'''' splice site within the caprine arthritis encephalitis virus genome: evidence for a novel auxiliary protein" pot

Báo cáo y học: " Characterization of a new 5'''' splice site within the caprine arthritis encephalitis virus genome: evidence for a novel auxiliary protein" pot

... using the primer 5'-TGCAAATAAATGGATCCAACAAGTAGCAAAAGT-3' (nt 5968 to 6000) Mutagenic primers 5'-GGGACAGCAAGCTAAGTATCAA3' (nt 6113 to 6134) and 5'-TATCAACCCCAGCTAAGTAAGCAA-3' (nt 6129 to 6152) were ... were Mar52 (5'-TAATCTGTGCAATACCAGAGCGGCT-3'; nt 131 to 155; forward primer) and M3b Primer pair MarN (5'-CAGCAAGGTAAGTATCAACCCCAG-3'; nt 6117 to 6140; forward primer) and M3b was used in a second ... Forward primer M5e (5'-GGAATTCATGGATGCTGGGGCCAGATAC-3'; nt 6012 to 6032) and reverse primer M3b (5'-CGGGATCCGCAAGCAGCAAGCTTCTCCTTATATA-3'; nt 9098 to 9073) contained EcoRI and BamHI sites at their...

Ngày tải lên: 13/08/2014, 06:20

17 423 0
Báo cáo y học: "Dextran-70 to modulate inflammatory response after cardiopulmonary bypass: potential for a novel approac" docx

Báo cáo y học: "Dextran-70 to modulate inflammatory response after cardiopulmonary bypass: potential for a novel approac" docx

... anti-inflammatory therapies Additionally, a combination of plasma inflammatory mediators and gene array analysis may lead to the identification of patients being more susceptible to harmful effects ... coronary artery bypass grafting J Thorac Cardiovasc Surg 1996, 111:469-77 Kawamura T, Inada K, Nara N, Wakusawa R, Endo S: Influence of methylprednisolone on cytokine balance during cardiac surgery ... Inflammatory response and myocardial injury following coronary artery bypass grafting with or without cardiopulmonary bypass Eur J Cardiothorac Surg 2000, 17:737-42 Al-Ruzzeh S, Nakamura K, Athanasiou...

Ngày tải lên: 13/08/2014, 08:20

2 206 0
Báo cáo y học: "Platelet-derived exosomes induce endothelial cell apoptosis through peroxynitrite generation: experimental evidence for a novel mechanism of septic vascular dysfunction" pot

Báo cáo y học: "Platelet-derived exosomes induce endothelial cell apoptosis through peroxynitrite generation: experimental evidence for a novel mechanism of septic vascular dysfunction" pot

... group of M.Z Ratajczak demonstrated that platelet microparticles could activate intracellular signaling pathways such as ERK and Akt, inducing angiogenesis and metastasis in lung cancer and promoting ... read and approved the final manuscript Acknowledgements LRL and MJ have research grants from Fundação de Amparo a Pesquisa Estado de São Paulo – FAPESP MJ received a research grant from Sociedade ... Because exosomes are, on average, too small for cytometry analysis, we believe that our data correspond to aggregates formed after ultracentrifugation For this reason we did not attempt to perform...

Ngày tải lên: 13/08/2014, 08:20

12 290 0
Characterization of lung dendritic cells in a novel murine model of asthma

Characterization of lung dendritic cells in a novel murine model of asthma

... experimental models because of advantages such as the availability of various transgenic animals, the wide array of reagents available for analysis, the low cost of maintenance and the 20 CHAPTER ... parenchyma has significant limitations Characteristic features airway remodelling of human asthma such as intraepithelial recruitment of eosinophils, lamina propria inflammation and subepithelial fibrosis ... fibrosis are virtually absent in these models 1.2.2 Ovalbumin asthma model vs dust mite asthma model For years, conventional animal sensitization models have relied heavily on a non-respiratory allergen-ovalbumin...

Ngày tải lên: 10/09/2015, 09:04

205 413 0
w