... bundle saved in onSaveInstanceState() is also passed to onCreate() In all cases, the saved bundle is passed to the onRestoreInstanceState() function, so it is more natural to utilize this to restore ... environments is an impossible task Android has therefore been constructed to ensure as uniform an experience across platforms as possible By abstracting the hardware differences,Android OS tries to insulate ... RAMdisk to RAM for quick access .The microprocessor then executes instructions and pages portions of the system and data images into RAM as needed .The radio image resides on the baseband processor,...
Ngày tải lên: 12/04/2014, 09:56
elite trader’s secrets - market forecasting with the new refined elliott wave principle pattern recognition system - rich swannell
... discovered by its founder, R.N Elliott in the 1930 s it has since gained wide acceptance as a legitimate market analysis and forecasting tool The Wave Principle, as it is sometimes called, is ... corrected its weaknesses, and the result is an exceptionally accurate market analysis method and forecasting tool Please join with us in sharing the benefits of years of research into the Elliott ... our software could compare millions of these forecasts with subsequent real market action – and determine their accuracy The results may surprise you They certainly surprised us We have discovered,...
Ngày tải lên: 16/04/2014, 16:26
Báo cáo toán học: "A note on the space of pseudodifferential projections with the same principal symbol " pptx
Ngày tải lên: 05/08/2014, 15:21
Báo cáo toán học: "An Infinite Family of Graphs with the Same Ihara Zeta Function" potx
... times is the same as the number of circuits in Ln which use the bridge 2k times From this, we conclude that the number of primitive circuits satisfying this property are the same in each graph As ... for several valuable discussions that led to this proof method and for reading and commenting upon the manuscript The author would also like to thank Yaim Cooper for several discussions as well ... combinatorics 17 (2010), #R82 must use the bridge edge an even number of times Suppose we are considering circuits which use the bridge edge 2k times In this case, the number of such circuits in Rn...
Ngày tải lên: 08/08/2014, 12:22
C H A P T E R 35 P Types of Poems Poetry POETRY SHARES many of the same elements as fiction, but doc
... sentences sometimes cut across line breaks and even sometimes stanzas, the visual separation of words within those sentences helps poets set off particular words and ideas for emphasis Any word at the ... this book.) To make information easier to process, business writers will also use bulleted or numbered lists as often as possible, especially when providing instructions It is easier to see the ... tell is the main idea Essays will often make their main idea clear in a thesis statement This statement is likely to come at the beginning of the essay Notice how the author below states his thesis...
Ngày tải lên: 18/06/2014, 17:20
Báo cáo y học: " A Novel Variable Number of Tandem Repeat of the Natriuretic Peptide Precursor B gene’s 5’-Flanking Region is Associated with Essential Hypertension among Japanese Females"
... analysis Data are presented as the mean ± SD The Hardy-Weinberg equilibrium was assessed by doing chi-square (χ2) analysis Differences in the clinical data between the EH and NT groups were assessed ... plasma BNP levels were found to be associated with an increased risk of BP progression in males, but not in females [22] Further studies are needed to resolve these conflicting results Since there ... we assessed the association between mutations or polymorphisms in the 5’-flanking region of NPPB and the presence of EH In the present study, a novel VNTR was discovered, and a significant association...
Ngày tải lên: 26/10/2012, 10:04
Cancer Research UK’s strategy 2009–2014: Cancer Research UK’s aim is to reduce the number of deaths from cancer. Our future plans are ambitious, but they are in line with the challenge and the responsibility we face. docx
... our goals, we need the best biomedical scientists, the best clinical researchers and the best research leaders Moreover, we must promote cross-disciplinary research with physicists, chemists, engineers ... 2020 goals Over the last 20 years, CRT has established itself as one of the most successful technology transfer organisations in the world and has, more recently, added early drug discovery capabilities ... 4,500 scientists, doctors and nurses throughout the UK We fund research carried out in our own Institutes, as well as awarding grants to researchers based in universities and hospitals We are also...
Ngày tải lên: 22/03/2014, 16:21
WORKING PAPER SERIES NO 1471 / SEPTEMBER 2012: FEEDBACK TO THE ECB’S MONETARY ANALYSIS THE BANK OF RUSSIA’S EXPERIENCE WITH SOME KEY TOOLS pdf
... it is not clear if these high money growth rates were fully justified The growth of asset prices also increased sharply during this period As the financial crisis manifested itself in the Russian ... aggregates The loss of access to foreign borrowing, the contraction of deposits, interest rates increases as well as the decline of the demand for loans during the severe recession caused decreasing ... Money-based inflation risk indicators We use money-based inflation risk indicators in order to assess the long-run link between monetary growth and inflation Thus, the assessment of risks to price stability...
Ngày tải lên: 22/03/2014, 21:20
Báo cáo y học: "Relaxin''''s induction of metalloproteinases is associated with the loss of collagen and glycosaminoglycans in synovial joint" ppsx
... different sites, including the pubic symphysis and synovial joints These findings also suggest that in fibrocartilaginous tissues, including the TMJ disc and possibly the pubic symphysis, relaxin ... characterized the responses of the pubic symphysis fibrocartilage and articular cartilage to the hormones MS retrieved tissues from animals and assisted in several MMP assays SK conceived the study, ... this hypothesis Additional studies are indicated to address the mechanistic basis for the differences in responsiveness of fibrocartilaginous versus cartilaginous cells to relaxin Our findings...
Ngày tải lên: 09/08/2014, 06:22
Tài liệu Decision Analysis and Risk Management: Two Sides of the Same Coin pdf
... understanding how “good” a decision is “Good” means how thoroughly and effectively uncertainties have been considered in the pre-decision analysis Decision analysis is the process of dissecting the ... uncertainties (risks) are considered in the decision making process The highest quality decisions are the ones that have the least unknowns In other words, they are made with the most knowledge about possible ... thoroughness of the analysis determines the “quality” of the decisions High quality decisions are not the best decisions in hindsight They are the best decisions in foresight A high quality decision may...
Ngày tải lên: 10/12/2013, 17:15
Tài liệu In this lab, 2 ISDN routers are required. If ISDN routers are not available, review the lab to become familiar with the process. An Adtran Atlas550 ISDN emulator is used to simulate the switch/ISDN cloud. pdf
... Ethernet (E0) Ethernet (E1) Serial (S0 ) Serial (S1 ) 1700 FastEthernet (FA0) FastEthernet (FA1) Serial (S0 ) Serial (S1 ) 2500 Ethernet (E0) Ethernet (E1) Serial (S0 ) Serial (S1 ) 2600 FastEthernet 0/0 ... interfaces the router has There is no way to effectively list all of the combinations of configurations for each router class What is provided are the identifiers for the possible combinations of ... series routers Any other router used may produce slightly different output Conduct the following steps on each router unless specifically instructed otherwise Start a HyperTerminal session as...
Ngày tải lên: 21/12/2013, 19:15
Tài liệu The King''''s Post Being a volume of historical facts relating to the Posts, Mail Coaches, Coach Roads, and Railway Mail Services of and connected with the Ancient City of Bristol from 1580 to the present time pdf
... by the King 's forces Prideaux was appointed Master of the Posts by Parliament, and his jurisdiction extended as far as the country was under the control of Parliament, as distinguished from such ... house, where he amassed a good fortune He then opened the Sadler 's Wells and was assisted by James Perry, the most celebrated mimic of his time, who assumed the name of Rossignal He[Pg 82] was ... Palmer 's scheme This is signed Thomas Symons, Bristol, and describes the scheme as the most beneficial plan that ever was thought of for a commercial country He also complains of the misconduct[Pg...
Ngày tải lên: 17/02/2014, 02:20
Tài liệu CALIFORNIA’S CONTAMINATED GROUNDWATER-Is the State Minding the Store? doc
... also listed on the CERCLIS database) The second report showed 665 sites with suspected releases (57 of which were also on the CERCLIS database) Figure shows the extent of overlap between the state ... Subtitle C.57 There is no single repository for information on sites that not pass the pre-CERCLIS screening process.58 Once a site is listed in the CERCLIS database, it is further evaluated ... uses that the state has assigned for them The report uses EPA s classification of waters as: (1) not supporting their designated beneficial uses, (2) partially supporting their beneficial uses,...
Ngày tải lên: 17/02/2014, 10:20
Tài liệu Báo cáo khoa học: Down-regulation of heme oxygenase-2 is associated with the increased expression of heme oxygenase-1 in human cell lines docx
... cultured human cells Discussion We have shown that the selective knockdown of HO-2 expression with each of two different siRNAs is consistently associated with increased expression of HO-1 mRNA ... the indicated cell lines and subjected to northern blot analysis and (B) western blot analysis (A) Northern blot analysis Each lane contains 15 lg total RNA The bottom panel shows the expression ... for transfection with siRNA Other methods are same as in Fig (A and C) Northern blot analysis of HO-1, HO-2 and GAPDH mRNAs The intensity of the signals representing HO-1 or HO-2 mRNA was normalized...
Ngày tải lên: 19/02/2014, 05:20
Tài liệu Báo cáo khoa học: Hu-K4 is a ubiquitously expressed type 2 transmembrane protein associated with the endoplasmic reticulum ppt
... LNGTPAL.AYLASAPPPLCPSGRTPDLKALLNVVDNARSFIYVAVMNYLPTLEFSHPHR LNGTPAL.AYLASAPPPLCPSGRTPDLKALLNVVDSARSFIYIAVMNYLPTMEFSHPRR LNSTASQ.VYLSSSPPPLSATGRTDDLQSIMNIIDDAKKFVYISVMDYSPTEEFSHPRR VSGVP.HSVFIASAPQQLCTMERTNDLTALLSCIRNASKFVYVSVMNFIPII.YSKAGKI ... isomerase hints at a localization in the endoplasmic reticulum (Fig 6) although an obvious retrieval signal is missing The human phospholipases D1 and D2 are mainly associated with the plasma membrane ... FWPAIDDGLRRATYERGVKVRLLISCWGHSEPSMRAFLLSLAALRDNHTHSDIQVKLFV FWPAIDDGLRRAAYERGVKVRLLISCWGHSDPSMRSFLLSLAALHDNHTHSDIQVKLFV YWPEIDNHLRKAVYERNVNVRLLISCWKNSRPSMFTFLRSLAALHSNTSHYNIEVKIFV LFWPYIEDELRRSAIDRQVSVKLLISCWQRSSFIMRNFLRSIAMLKSKN...
Ngày tải lên: 19/02/2014, 17:20
Théorie des Fonctions Elliptiques, by Charles Briot and Jean Claude Bouquet This eBook is for the use of anyone anywhere at no cost and with almost no restrictions whatsoever docx
... les arcs bc, ce, eb, et ainsi de suite Mais chacune des transversales ae, be, ce, de est parcourue deux fois dans des sens oppos s, ce qui donne des variations ộgales et de signes contraires ... fonctions, nous nous occupons spộcialement des fonctions doublement pộriodiques Les fonctions elliptiques sont les plus simples dentre elles Ce sont les intộgrales elliptiques qui se sont prộsentộes dabord ... des aires partielles dans le sens positif Considộrons laire enveloppộe par la courbe abcd (g 10), et qui est divisộe en quatre parties par des transversales Nous supposons quaucune des lignes...
Ngày tải lên: 06/03/2014, 16:20
Pioneer Introduces the New CYBER NAVI Car Navigation system in Japan With the world’s first* Head-Up Display to project augmented reality information in front of the windscreen* pot
... detects and displays speed limit signs, notifying the driver with a sound effect when a sign is detected This device also meets the needs of users who want to always have the latest map data, with ... Cruise Scouter unit*4 As well as improving on existing functions, new functions have also been added ・Speed sign detection When a speed sign is detected ahead, an image of the speed sign is displayed ... Corporation * The images in the presentation materials are artist s impressions, and may not be the same as the actual items Options Product Model AR HUD unit ND-HUD1 Cruise Scouter unit ND-CS2 Suggested...
Ngày tải lên: 07/03/2014, 11:20
Báo cáo khoa học: N-Methylation in polylegionaminic acid is associated with the phase-variable epitope of Legionella pneumophila serogroup 1 lipopolysaccharide pptx
... moreover, the relative intensity of these signals was the highest compared to other pools from the same strain Therefore, further structural investigation was performed with this preparation The 1H ... alterations may occur upon phase variation and the loss of the mAb 2625 epitope is one of them Phase variation in L pneumophila was found to in¯uence other LPS biosynthesis pathways involved in assembly ... the OPS of the LPS In this case, silver-stained SDS/PAGE showed only low-molecular-mass molecules resembling rough-type LPS, which did not react with mAb 2625 in Western blot In contrast to the...
Ngày tải lên: 08/03/2014, 10:20
Burgoyne''''s Invasion of 1777 With an outline sketch of the American Invasion of Canada, 1775-76. pot
... as at home, on the sea as on the land Burgoyne 's disaster has been charged to the grossest carelessness on the part of some under official of the British War Office It is said that the orders ... of the king 's discontent by declaring for aggressive war, smoothed every obstacle away with easy assurance, and so impressed the ministers with his capacity, that they believed they had found the ... lost two thousand men in assaulting these lines in 1758 Since then they had been greatly strengthened [20] THROUGH OLD PATHS The Indians had passed this way centuries before the fortress was...
Ngày tải lên: 08/03/2014, 12:20