lựa chọn đề tài và viết chuyên đề tn

Ngày tải lên: 05/12/2016, 10:15

Ngày tải lên: 06/03/2014, 08:20

... hair/fur loss defects in the Mouse Locus Catalog Slc30a4 tf tf comment Slc30a4 St§ Tgfb1† Tgfbi† Tnfrsf6† wal 15 wal 18 10 14 2 The term heading each column was used to search the Mouse Locus Catalog...

Ngày tải lên: 14/08/2014, 14:21

Ngày tải lên: 29/06/2016, 23:52

... service have you used in Vietnam? What is your opinion about the services you has used in Vietnam? The quality of tour guide in Vietnam is: Your search information about Vietnam by: Do you often use ... have you visited Vietnam? Why did you choose Viet Nam for your travel? Have you visited some famous destinations and world heritages in Vietnam? Which is the destination in Vietnam you like the ... you ever tasted some traditional foods in Vietnam? 16.If yes, where did you try it? 17.How you feel about traditional food in Vietnam? 18.What is Vietnamese food you like most? 19.What is your...

Ngày tải lên: 25/04/2013, 15:42

Ngày tải lên: 01/11/2013, 14:20

Ngày tải lên: 01/11/2013, 14:20

Ngày tải lên: 21/12/2013, 06:16

Ngày tải lên: 17/01/2014, 08:20

... 3.1.4 Knowledge management 3.1.5 Correctness of the term “knowledge management” 3.1.6 Strategies in knowledge management ... controlled source and open source The first one refers to the corporate environment, second to partners and third to completely open Internet environment IBM, Hewlett Packard, SUN Microsystems, ... organization is taking managerial actions, which satisfy their knowledge-related objectives 3.1.5 Correctness of the term “knowledge management” Some authors promoting the community view argue, that the...

Ngày tải lên: 24/01/2014, 00:20

Ngày tải lên: 24/01/2014, 10:20

... Xi, K.W Ross (2005b) Pollution in P2P File Sharing Systems, Infocom 05, Miami Love, Courtney (2000) “Courtney Love does the math.” Salon http://dir.salon.com/tech/feature/2000/06/14/love/index.html ... Unfortunately, we not know much about the accuracy of survey data in the context of file sharing As Zentner (2006) points out, some individuals might play down their file sharing because they understand ... displacement rates ranging 3.5% for movies (Rob and Waldfogel, 2007) to rates as high as 30% for music (Zentner, 2006).18 A typical estimate is a displacement rate of about 20% One implication of these results...

Ngày tải lên: 18/02/2014, 00:20

... (Cambridge, CUP, 1973, 1979), passim Thomas Hodgkin, Vietnam: the revolutionary path (London, Macmillan, 1981), 87–88 Thomas Hodgkin, Vietnam:, 89 Philip Webster, “Gordon Brown brings economic ... the current class’s rule, tolerating no heretics Economics props up Prince Rupert.58 As Paul McCartney’s frogs sing to his animated Rupert Bear, “We’ll all stand together!” It is possible that the ... the eight and a half centuries since liberation, Nguyen Hue proclaimed himself emperor of 97 Vietnam He took the name of the current period, Quang Trung “He agreed to accept office, inaugurating...

Ngày tải lên: 20/02/2014, 16:20

... VKENSYEIVCEFSG EIELRM-GNE QEAWSSISNKRPIYSRTFKTLS-EGSTNTT-T T-GETFKVDLSFSAK -SKASTFAIALRASA V-LPDSINVV-DKLKKKNVKLTNKKPIKTN-FKGS-TGLFDFNITFKVLNLNVS PGKTHFDILI-NSQ VREVERLRTKQVKNLRN-KVLKSGSRLEVYGV ... IGSKA-TLVQQP TRFVDIGKDFYAFQTF-SEVE H-GVLGLAWASNWQ YADQV-PT NPWRSSTSLARNYTLRYVHTNAETKQ -L-TLIQNP MDGTAPRYDYG-KYYASKTF-F-DSAKN-RRILWGWTNE-S S SVEDDVEKGWSGIQTIPRKIWLDR S -GKQLIQWP DLRYDYG-QFYASKSF-F-DDAKN-RRVLWAWVPE-T ... DGSGMWECPDFFPVTR-F-GSNGVETSSFGEPNEILKHVLKISLDD TKHDYYTIGTYDRVKDKFVPDN GFK -DATGTWECPDFYPVPL-N-STNGLDTSVYG -GSVRHVMKAGFE GHDWYTIGTYSPDRENFLPQNGLSLTGSTL 3PIG 1UYP 1Y4W 3KF5 2AC1 2ADE 292...

Ngày tải lên: 06/03/2014, 00:21

... malignant cells through activation of caspase 3, bypassing Fas/FasL and tumor necrosis factor (TNF)/TNFR-dependent pathways and does not require upstream activation of receptor-dependent initiatory ... G.T (1999) a-Fetoprotein causes apoptosis in tumor cells via a pathway independent of CD95, TNFR1 and TNFR2 through activation of caspase-3-like proteases Eur J Biochem 266, 1–13 Semenkova, L.N.,...

Ngày tải lên: 08/03/2014, 08:20

... cực vào việc thực thành cơng chiến lược đưa đất nước trở thành nước cơng nghiệp theo hướng đại vào năm 2020 GIỚI THIỆU VỀ ĐỀ ÁN “ĐƯA VIỆT NAM SỚM TRỞ THÀNH NƯỚC MẠNH VỀ CƠNG NGHỆ THƠNG TIN VÀ ... Vietnam 2011 TIÊU ĐIỂM TIÊU ĐIỂM trung, sở nghiên cứu, đào tạo, doanh nghiệp, cá nhân cung cấp sản phẩm, dịch vụ CNTT I Trên quan điểm đạo mục tiêu đề ra, Đề án đưa nhóm nhiệm vụ tập trung vào ... of NSCICT (at MIC) 23 ICT Vietnam 2011 HỆ THỐNG TỔ CHỨC VỀ CƠNG NGHỆ THƠNG TIN VÀ TRUYỀN THƠNG 2.2 CHỨC NĂNG VÀ NHIỆM VỤ HỆ THỐNG TỔ CHỨC VỀ CƠNG NGHỆ THƠNG TIN VÀ TRUYỀN THƠNG Ban Chỉ đạo có...

Ngày tải lên: 09/03/2014, 11:20

Ngày tải lên: 16/03/2014, 19:20

Ngày tải lên: 17/03/2014, 07:20

Ngày tải lên: 23/03/2014, 04:20