0

jasmonate biosynthesis perception and function in plant development and stress responses

Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 1

Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 1

Cao đẳng - Đại học

... MAP kinase, MAP kinase kinase (MAPKK) and MAP kinase kinase kinase (MAPKKK) G-protein mediated mating signaling activates Ste11, a MAPKKK in S cerevisiae Ste11, in turn, phosphorylates and activates ... during mating and virulence, and MAP kinase cascade that senses pheromone during mating, and also regulates haploid fruiting and virulence (Wang and Heitman 1999) MAP kinase and cAMP signaling regulate ... from Siderovski and Willard, 2005, Int J Bio Sci., 1: 51-66) 21 signaling mutants in Arabidopsis and rice have added to a better understanding of G protein signaling functions in plants The genomes...
  • 220
  • 228
  • 0
Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 2

Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 2

Cao đẳng - Đại học

... PLTPHRVRLTKIDHTFLSEDAINNLGSLKFSQSNRMPDPKDVARIVTTTTTTTFSMAKEM PLSAHRVRLTKVEHTFLSEDAINNLGSLKFSQSNRMPDPKDPSRIVTTTTTTTFSMAKDM -LDSHRVRFTKYDHTFTSEEAINNLGSLKFSQSNRMPDPKDPSRIVTTTTTTTFSMAKEM TFEKSKPEQGWQAQIGNIDINDLERVSPLAHRFFTNPDSESHTQYYVSNAGIRLFENKTF ... GLVGVKMAKERKINDKIYMNTFTGK-AAVDWLMDCSTTIERRETVLIAELFVKYGLITML GFSQDMLISSSNLNKLDYVLTDPGMRYLFRRHLEKELCVENLDVFIEIKRFLKKMTILKK Rgs1 Cprgs-1 FlbA Sst2 467 272 479 466 QQDRSHIQQFPGCQVFQPTKHAIYHMTSKGKDMINGSVPRGRASEGDATHSATHRHG-VA ... RGS1 Figure 21 A rgs1D WT Rgs1 OP Complemented B WT rgs1D Complemented Rgs1 OP _ Figure 22 Inductive Non-inductive _ Figure 23 WT rgs1D Complemented Figure 24 Figure 25 Figure 26 Rgs1 MG00990 MG03146...
  • 12
  • 185
  • 0
Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 3

Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 3

Cao đẳng - Đại học

... Figure 28 Inductive Non-inductive _ Figure 29 Figure 30 Inductive Non-inductive _ Figure 31 B A Figure 32 A B Figure 33 A B Figure 34 mgb1D ... WT _ rgs1Dmgb1D magB G183Smgb1D Figure 35 Figure 36 MG010315 MG010105 MG09134 Control: Gamma actin MG03982 MG01173 MG01630 Figure 37 A B ...
  • 11
  • 227
  • 0
Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 4

Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 4

Cao đẳng - Đại học

... 8-Br-cAMP 10mM 8-Br-cAMP _ B WT rgs1D Figure 45 Appressorium formation on inductive membrane (%) Appressorium formation on Noninductive membrane (%) WT 89 1.5 mscL∆ 92 mscS1∆ 87 2.5 mscS2∆ 91 mscS3∆...
  • 9
  • 180
  • 0
Characterization of pin1 function in zebrafish development

Characterization of pin1 function in zebrafish development

Tổng hợp

... cell cycle and cancer 1.1.3.1 Pin1 function in M phase 1.1.3.2 Pin1 function in G1 and S phase 1.1.3.3 Pin1 function in oncogenesis .9 1.1.4 Pin1 function in apoptosis ... Pin1 X-ray structure of human Pin1 complexed with dipeptide Ala-Pro Pin1 contains two domains: N-terminal WW domain and C-terminal PPIase domain The two domains are connected by a flexible linker ... proteins, Pin1 affects their stability by interfering with this process 1.1.7.2 The role of Pin1 in protein stability A series of proteins can be stabilized by Pin1; these proteins include cyclin...
  • 166
  • 223
  • 0
Tài liệu Báo cáo khoa học: Metabolic gene switching in the murine female heart parallels enhanced mitochondrial respiratory function in response to oxidative stress pdf

Tài liệu Báo cáo khoa học: Metabolic gene switching in the murine female heart parallels enhanced mitochondrial respiratory function in response to oxidative stress pdf

Báo cáo khoa học

... additional insights into this interesting question Conclusions In summary, we have identified a novel metabolic gene switch (decrease in fatty acid utilization, increase in glucose utilization) in the ... (ATP) and oxygen results in the emission of light The intensity of the bioluminescence was detected using a luminometer, and the mitochondrial ATP concentration was determined Mitochondrial protein ... Arch Intern Med 155, 57–61 Bae S & Zhang L (2005) Gender differences in cardioprotection against ischemia ⁄ reperfusion injury in adult rat hearts: focus on Akt and protein kinase C signaling...
  • 7
  • 582
  • 0
Reproductive System Structure, Development and Function in Cephalopods with a New General Scale for Maturity Stages pot

Reproductive System Structure, Development and Function in Cephalopods with a New General Scale for Maturity Stages pot

Sức khỏe phụ nữ

... rigid capsules, capsule glands and albumin glands are present in a complex of pallial glands These differ in their origin and function (Chukchin, 1984) Oviductal glands in octopus secrete an adhesive ... oocytes in the coelom, and usually a single spawning, occur in octopus of the suborder Incirrata Octopus zonatus, in which repeated spawning has been observed (Rodaniche, 1984), is an exception In ... complicated than in females, especially because of the greater number of accessory glands involved in spermatophore formation ARKHIPKIN: Reproductive System Structure, Development and Function in Cephalopods...
  • 12
  • 623
  • 0
báo cáo khoa học:

báo cáo khoa học: " Modification of tobacco plant development by sense and antisense expression of the tomato viroid-induced AGC VIIIa protein kinase PKV suggests involvement in gibberellin signaling" doc

Báo cáo khoa học

... signalling pathways in Arabidopsis and the AGC protein kinases Trends Plant Sci 2003, 8:424-431 Benjamins R, Quint A, Weijers D, Hooykaas P, Offringa R: The PINOID protein kinase regulates organ development ... resulted in a taller stature and increased numbers of influorescences in transgenic plants The combined results of reversal of stunting in plants over expressing PKV by exogenous application of GA and ... regulates plant development by functioning in critical signaling pathways involved in GA metabolism and GA-regulated transcriptional networks Our findings establish a foundation to further investigate...
  • 14
  • 224
  • 0
Báo cáo y học:

Báo cáo y học: "Global transcriptome analysis reveals circadian regulation of key pathways in plant growth and development" potx

Báo cáo khoa học

... transcripts, including the following: RNA processing; DNA synthesis and chromatin structure; protein synthesis, secretion, and ubiquitin-mediated degradation; G-proteinmediated signaling; and cell ... E: Integration of abscisic acid signalling into plant responses Plant Biol 2006, 8:314-325 Fleet CM, Sun TP: A DELLAcate balance: the role of gibberellin in plant morphogenesis Curr Opin Plant ... acid and jasmonic acid in pathogen defence Plant Biol 2006, 8:307-313 Wasternack C: Jasmonates: an update on biosynthesis, signal transduction and action in plant stress response, growth and development...
  • 18
  • 400
  • 0
 Báo cáo y học:

Báo cáo y học: " High blood pressure, antihypertensive medication and lung function in a general adult population"

Y học thưởng thức

... Conclusions Our findings are in line with previous observations showing an inverse association between blood pressure and lung function Furthermore, our analysis indicates that BBL medication and not ... Relationship between lung function and blood pressure in Chinese men and women of Beijing and Guangzhou PRC-USA Cardiovascular and Cardiopulmonary Epidemiology Research Group Int J Epidemiol 1998, ... of high blood pressure and antihypertensive medication Thus, it allows only statements about a single point in time and does not allow evaluating the effect of long-standing high blood pressure...
  • 8
  • 579
  • 1
Tài liệu Lipases and Phospholipases in Drug Development pptx

Tài liệu Lipases and Phospholipases in Drug Development pptx

Sức khỏe giới tính

... 81 Mg2+-independent Neutral Sphingomyelinases 84 Alkaline Sphingomyelinase from the Intestinal Tract 85 Bacterial Sphingomyelinase-phospholipase C 85 Sphingomyelinase Mechanism 85 Binding of Magnesium ... Alonso Introduction and Scope Sphingomyelinases 80 Types of Sphingomyelinases 80 Acid Sphingomyelinase (aSMase) 80 Secretory Sphingomyelinase (sSMase) 81 Neutral, Mg2+-dependent Sphingomyelinases ... Ions 85 Binding of Substrate 85 Mechanism of Catalysis 86 Sphingomyelinase Assay 88 Sphingomyelinase Inhibitors 89 Sphingomyelinase–Membrane Interactions 89 Lipid Effects on Sphingomyelinase Activity...
  • 357
  • 1,339
  • 1
Tài liệu Báo cáo khoa học: Verprolin function in endocytosis and actin organization Roles of the Las17p (yeast WASP)-binding domain and a novel C-terminal actin-binding domain doc

Tài liệu Báo cáo khoa học: Verprolin function in endocytosis and actin organization Roles of the Las17p (yeast WASP)-binding domain and a novel C-terminal actin-binding domain doc

Báo cáo khoa học

... previously showed does contain an actinbinding domain (this actin-binding domain has not yet been mapped) [23] We name the actin-binding domain that we have identified VH2-C and VH2-N because it is ... domain structure Schematic of Vrp1p showing the Vrp1p truncations and mutant proteins used in this study and their various known domains: actin-binding domains, Hof one trap (HOT) domain, and ... only expressing Gal4-AD (AD-vect) Plasmids were introduced into the tester strain PJ69-4A and interaction was assessed by growth on medium lacking histidine and containing mM 3-amino 1,2,4-triazole...
  • 23
  • 679
  • 0
Tài liệu Báo cáo khoa học: Structure and function of plant aspartic proteinases pptx

Tài liệu Báo cáo khoa học: Structure and function of plant aspartic proteinases pptx

Báo cáo khoa học

... implicated in protein processing and/ or degradation in different plant organs, as well as in plant senescence, stress responses, programmed cell death and reproduction Protein processing and/ or degradation ... including specific protein processing (e.g rennin, cathepsin D and yapsins), protein degradation (e.g gastric enzymes such as chymosin, pepsin and gastricsin) or viral polyprotein processing (human immunodeficiency ... role in defense responses of potato plants against pathogens or insects has been suggested The inhibition of the potato tuber AP by a PR-protein may also suggest its involvement in plant stress responses...
  • 9
  • 605
  • 0
Tài liệu Báo cáo khoa học: Inorganic pyrophosphatase in the roundworm Ascaris and its role in the development and molting process of the larval stage parasites doc

Tài liệu Báo cáo khoa học: Inorganic pyrophosphatase in the roundworm Ascaris and its role in the development and molting process of the larval stage parasites doc

Báo cáo khoa học

... (Michaelis constant) and Vmax (maximum velocity) values were determined by incubating the diluted recombinant proteins in the standard reaction mixture in the presence of increasing concentrations ... were removed and minced with a surgical knife The minced tissue was wrapped in cotton gauze and suspended in NaCl/Pi containing 100 lgÆmL)1 penicillin/ streptomycin at 37 °C for h After incubation ... were incubated at 37 °C in a humidified 5% CO2 incubator in the absence (control) and presence of increasing concentrations of inhibitors for 10 days, and the number of molting larvae was determined...
  • 13
  • 691
  • 0
Ironies in Organizational Development Second Edition, Revised and Expanded pdf

Ironies in Organizational Development Second Edition, Revised and Expanded pdf

Cao đẳng - Đại học

... mechanical, including photocopying, microfilming, and recording, or by any information storage and retrieval system, without permission in writing from the publisher Current printing (last digit): 10 PRINTED ... complex, as in seeking to understand interpersonal conflict as an expression of differing personal predispositions, or as in designing and interpreting opinion surveys Skill-building activities, ... and guesses reflected in this volume OD values more clearly and insistently apply in the kind of society and economy we seem to be becoming: more educated and with a growing range of options and...
  • 699
  • 913
  • 0
The Role of Small and Large Businesses in Economic Development doc

The Role of Small and Large Businesses in Economic Development doc

Tài chính doanh nghiệp

... example, in Canada (Morisette), Germany (Schmidt and Zimmermann), Austria (Winter-Ember), the United Kingdom (Belfield and Wei), and Switzerland (Winter-Ember and Zweimüller), among others Kraybill and ... greater returns by investing the same resources in creating a more conducive business environment for existing firms—both large and small Thus, recruiting large firms is often costly, in both direct ... Transportation and Warehousing 27,772 32,307 39,101 140.8 Information 40,728 52,292 60,308 148.1 Finance and Insurance 45,001 59,279 69,971 155.5 Real Estate and Rental and Leasing 29,794 35,352...
  • 25
  • 660
  • 0
Báo cáo khoa học: Enzymes of creatine biosynthesis, arginine and methionine metabolism in normal and malignant cells Soumen Bera1, Theo Wallimann2, Subhankar Ray1 and Manju Ray1 potx

Báo cáo khoa học: Enzymes of creatine biosynthesis, arginine and methionine metabolism in normal and malignant cells Soumen Bera1, Theo Wallimann2, Subhankar Ray1 and Manju Ray1 potx

Báo cáo khoa học

... arginase I and ODC direct ornithine towards polyamine synthesis and the mitochondrial enzymes arginase II and ornithine aminotransferase favor the channeling of ornithine to proline ⁄ glutamine ... estimation of proline and ornithine J Biol Chem 199, 91–95 45 Van Pilsum JF, Martin RP, Kito E & Hess J (1956) Determination of creatine, creatinine, arginine, guanidinoacetic acid, guanidine, and methyl-guanidine ... GAMT in EAC and S180 cells and in sarcoma tissue indicates that the upregulated proteins are entirely tumor-cell specific On the other hand, the in ux and efflux rate of creatine in both EAC and...
  • 11
  • 626
  • 0
Báo cáo khoa học: Amino acids Thr56 and Thr58 are not essential for elongation factor 2 function in yeast potx

Báo cáo khoa học: Amino acids Thr56 and Thr58 are not essential for elongation factor 2 function in yeast potx

Báo cáo khoa học

... cystein, methionine and serine (Fig 2) Mutants containing asparagine, aspartic acid, glycine, lysine or valine were nonfunctional (Fig 2) Clones expressing eEF2 in which the adjacent threonine ... by recombination using LR clonase The destination vector was transformed into strain YOR133w for confirming gene expression, and into strain GB1 for functional analysis by plasmid shuffling A copy ... protein (MAP) kinase and mTOR-signalling pathways [17] These signalling pathways activate the eEF2 kinase in response to mitogens and other stimuli that increase the cellular energy demand [18–...
  • 13
  • 424
  • 0
Báo cáo khoa học: Plant DNA polymerase k, a DNA repair enzyme that functions in plant meristematic and meiotic tissues docx

Báo cáo khoa học: Plant DNA polymerase k, a DNA repair enzyme that functions in plant meristematic and meiotic tissues docx

Báo cáo khoa học

... recombinant proteins The results suggest that plant DNA Pol k is a DNA repair enzyme which functions in plant meristematic and meiotic tissues Materials and methods Plant materials Rice plants ... suggesting that the DNA polymerase activity of this enzyme may be important for plant cells On the other hand, the N-terminal BRCT domain proposed to mediate protein–protein interactions involved in ... participates in alignment-based gap filling for nonhomologous DNA end joining [33] Therefore, Pol k may participate not only in BER but also in DNA doublestrand break repair and meiosis, and Pol b and...
  • 9
  • 492
  • 0
Plant physiology - Chapter 17 Phytochrome and Light Control of Plant Development pptx

Plant physiology - Chapter 17 Phytochrome and Light Control of Plant Development pptx

Cao đẳng - Đại học

... higher -plant phytochromes have some homology with the kinase domains, they not function as histidine kinases Instead, they are serine/threonine kinases In addition, recombinant versions of higherplant ... involving changes in gene expression, phytochrome induces a variety of rapid responses, including chloroplast rotation in the alga Mougeotia, leaf closure during nyctinasty, and alterations in ... for plants growing in the environment In the discussion that follows we will learn how plants sense and respond to shading by other plants, and how phytochrome is involved in regulating various...
  • 29
  • 1,030
  • 3

Xem thêm