The Design and Implementation of a Log-Structured File System
... separate data area is reserved for this purpose. The separate data area of these database systems means that they do not need the segment cleaning mechanisms of the Sprite LFS to reclaim log space. ... under grant CCR-8900029, and in part by the National Aeronautics and Space Administration and the Defense Advanced Research Projects Agency under contract NAG2-591. This paper will appear in the ... illustrates the fact that a log-structured file system produces a different form of locality on disk than traditional file systems. A traditional file system achieves logical locality by assuming certain...
Ngày tải lên: 12/09/2012, 15:05
A study of water
... levels. National levels. River basin levels. Global levels. International levels. What is water scarcity? Imbalances between availability and demand. The degradation of groundwater and surfacewater ... chemicals, chemicals, gasoline and oils gasoline and oils are major users are major users of water of water Which solutions to slove? Addressing water scarcity requires at: Local levels. National ... these and many other water- related diseases. Thank you for listening! Now that one knows some Now that one knows some facts about industrial water facts about industrial water use, along...
Ngày tải lên: 25/04/2013, 15:20
DETOXIFICATION OF TRICHLOROETHYLENE (TCE) USING SOLAR LIGHT/TiO2 IN A UV CONCENTRATING RADIATION SYSTEM
Ngày tải lên: 05/09/2013, 08:40
PERFORMANCE OF A COMBINED CONSTRUCTED WETLAND SYSTEM FOR TREATING VILLAGE SEWAGE IN LAKE DIANCHI VALLEY
Ngày tải lên: 05/09/2013, 08:40
Occurrence of Tetracycline-Resistant and Tetracycline- Degrading Bacteria in Wastewater Treatment Plant Effluent and Environmental Water Systems
Ngày tải lên: 05/09/2013, 10:15
Spatial moment analysis of colloid facilitated radionuclide transport in a coupled fracture-matrix system
Ngày tải lên: 05/09/2013, 17:03
A distributed decision support system for building evacuation 2009
Ngày tải lên: 07/12/2013, 11:41
PROBE–A multicriteria decision support system for portfolio robustness evaluation
Ngày tải lên: 07/12/2013, 11:41
Tài liệu Installing a Cabinet on the Cement Floor docx
... 5 Positioning a cabinet close to an installed cabinet 6 Positioning cabinets abreast 7 Positioning cabinets back to back 8 Installing the expansion tube and expansion nut 9 Placing the insulation plate and ... 3500 Installation Manual If the measured resistance is less than 5 megaohm, it means that insulation is not sufficient. Remove all installation parts, and check whether there is no insulation plate ... of the cabinet already installed 5. Reference point Figure 1.1 Positioning a cabinet close to an installed cabinet Step 5 Use the layout marking plate mark all the four cabinet installation holes...
Ngày tải lên: 19/01/2014, 10:20
Tài liệu Installing a Cabinet on the Antistatic Floor doc
... 3500 Installation Manual 3 Installing a Cabinet on the Antistatic Floor 3 Installing a Cabinet on the Antistatic Floor About This Chapter When the installation is well prepared, install the cabinet. ... 3500 Installation Manual 3 Installing a Cabinet on the Antistatic Floor Step 3 Adjust the levelness of the cabinet by adding washers between the insulation plates and the support. See Figure 1.1. Caution If ... flat washer and spring washer, and all are screwed tight. No part of the cabinet is distorted. The exterior varnish and the marks on the cabinet should be kept intact, and the marks and...
Ngày tải lên: 19/01/2014, 10:20
Tài liệu Design of a Powerline Home Automation System pdf
... signal. Alarm system interface unit The alarm system delivered does not function as a complete home alarm system, but merely illustrates that the home automation system can interface ... interface with a larger existing alarm system. The alarm interface unit provides the home alarm system with an arm/disarm signal and reports back to the master unit the current integrity status of ... very important, as it means that on a noisy powerline circuit, home automation signals can be sent reliably, as long as the rate of transmission is low enough. Since a home automation system does...
Ngày tải lên: 19/01/2014, 20:20
Tài liệu A Hybrid Neural Fuzzy System for Statistical Process Control docx
... work for various applications, data transformation is necessary to standardize the raw data into the value range that both neural network components can work with. Formulas for data transformation are ... operations, etc. A QC can be mathematically defined as a random variable, which is a function that takes values from a population or distribution. Denote a QC as random variable x . If a population ... Tables 18.6 (a) and (b), to Acosta and Pignatiello’s (1996) EWMA chart which adopts Roberts’ (1959) EWMA for mean and Wortham’s and Heinrich’s (1972) EWMA for variance. To obtain a fair comparison,...
Ngày tải lên: 23/01/2014, 01:20
Tài liệu Installing a Driver ppt
... For example, a new sound card will most likely not work, or will work improperly. If the wrong drivers are installed. Also, using the latest driver is a good practice to follow. When installing ... is clean and free of any dust or debris. If the problem still exists after verifying the connection and cleaning, try restarting the machine. Rebooting the machine will refresh and reload the ... installing a new device, check the manufacturer’s web site for the latest drivers available for their product. If there are problems with the mouse pointer, verify that it is properly connected and...
Ngày tải lên: 24/01/2014, 19:20
Tài liệu Trade-Off Financial System Supply-Chain Cross-Contagion: a study in global systemic collapse. docx
... markets to crowd behaviour and ecosystems, they also share many similar dynamic features 18 . In figure 2 is a representation of a system, as a ball, at a particular time and in a particular ... De-localisation means that there are many more places and events that can transmit failure, and major structural stresses can build at a global scale. There is less local resilience to failure, ... years there are multiple routes to a large- scale breakdown in the global financial system, comprising systemic banking collapses, monetary system failure, credit and financial asset vaporization....
Ngày tải lên: 17/02/2014, 21:20
Tài liệu EFFORTS TO IMPLEMENT A FINANCIAL- MANAGEMENT INFORMATION SYSTEM IN IRAQ docx
Ngày tải lên: 18/02/2014, 04:20
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc
... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... DNA poly- merase was purchased from Toyobo (Osaka, Japan). Emul- gen 911 was a gift from Kao Chemical (Tokyo, Japan). NADPH, NADH and NADP + were purchased from Oriental Yeast (Tokyo, Japan). a- Cyano-4-hydroxycinnamic acid ... T m value of each protein at neutral pH. a Data from this study. b Data from Griffin et al. [32]. c Data from Yano et al. [4]. T. Mandai et al. Thermostable electron transport system FEBS Journal...
Ngày tải lên: 18/02/2014, 08:20
Tài liệu Báo cáo khoa học: Properties of ecdysteroid receptors from diverse insect species in a heterologous cell culture system – a basis for screening novel insecticidal candidates docx
... the aromatic moiety of dibenzoylhydrazines on larvicidal activity against the Colorado potato beetle Leptinotarsa decemlineata. Pest Manag Sci 57, 858–865. 36 Nakagawa Y, Minakuchi C, Takahashi ... Ogura T, Minakuchi C, Nakagawa Y, Smagghe G & Miyagawa H (2005) Molecular cloning, expression anal- ysis and functional confirmation of ecdysone receptor and ultraspiracle from the Colorado ... in a heterologous cell culture system – a basis for screening novel insecticidal candidates Joshua M. Beatty 1 , Guy Smagghe 2 , Takehiko Ogura 3 , Yoshiaki Nakagawa 3 , Margarethe Spindler-Barth 4 and...
Ngày tải lên: 18/02/2014, 08:20